Copy Link Print Information

Animal-Free IFN-beta 1b Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PDGF R beta protein is a receptor protein that binds to platelet-derived growth factor (PDGF). It is expressed in a variety of cells, including fibroblasts and smooth muscle cells. Animal-Free IFN-beta 1b Protein, Human (His) is the recombinant human-derived animal-FreeIFN-beta protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free IFN-beta 1b Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PDGF R beta protein is a receptor protein that binds to platelet-derived growth factor (PDGF). It is expressed in a variety of cells, including fibroblasts and smooth muscle cells. Animal-Free IFN-beta 1b Protein, Human (His) is the recombinant human-derived animal-FreeIFN-beta protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Background

The IFN-beta Protein encodes a cytokine belonging to the interferon family, released as part of the innate immune response against pathogens. This protein falls under the type I class of interferons, crucial for defense against viral infections, as well as participating in cell differentiation and anti-tumor defenses. Upon secretion in response to pathogens, type I interferons bind a homologous receptor complex, triggering the transcription of genes involved in inflammatory cytokines and chemokines. Aberrant activation of type I interferon secretion is associated with autoimmune diseases. Mice deficient for this gene exhibit several phenotypes, including defects in B cell maturation and increased susceptibility to viral infection, emphasizing the pivotal role of IFN-beta Protein in immune responses and host defense.

Verified Bioactivity

1.Measure by its ability to induce apoptosis in HeLa cells. The ED50 for this effect is <15 ng/mL.
2.Measure by its ability to induce cytotoxicity in TF-1 cells. The ED50 for this effect is <0.1 ng/mL. The specific activity of recombinant human IFN beta 1a is approximately >1 x107 IU/ mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P01574/NP_002167.1 (M22-N187)

  • Gene ID
    3456  [NCBI]
  • Molecular Construction
    • N-term
    • IFN-beta (M22-N187)
      Accession # P01574/NP_002167.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNB1; IFF; Prev. IFNB; Fibroblast Interferon; IFB; IFN-Beta; Interferon Beta; Interferon-Beta; Interferon Beta 1; Interferon, Beta 1, Fibroblast

  • AA Sequence

    MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

  • Predicted Molecular Mass

    20.8 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free IFN-beta 1b Protein, Human (His) Product Image
    1/16
  • Animal-Free IFN-beta 1b Protein, Human (His) Product Image