Animal-Free IL-1 beta Protein, Human (His)
Based on 1 Customer Validation
IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. Animal-Free IL-1 beta Protein, Human (His) is the recombinant human-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. Animal-Free IL-1 beta Protein, Human (His) is the recombinant human-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Background
IL-1 beta Protein stands as a potent pro-inflammatory cytokine, recognized for its diverse roles in orchestrating immune responses. Originally identified as a major endogenous pyrogen, IL-1 beta induces a cascade of inflammatory events, including prostaglandin synthesis, neutrophil influx and activation, T-cell and B-cell activation, cytokine production, as well as fibroblast proliferation and collagen production. It plays a pivotal role in immune cell differentiation, promoting Th17 differentiation of T-cells and synergizing with IL-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Additionally, IL-1 beta contributes to angiogenesis by inducing VEGF production, working synergistically with TNF and IL-6. Notably, it plays a key role in transducing inflammation downstream of pyroptosis, being specifically released into the extracellular milieu through the gasdermin-D (GSDMD) pore. In the context of microbial infection, IL-1 beta acts as a sensor of S. pyogenes infection in the skin, undergoing cleavage and activation by the pyogenes SpeB protease, leading to an inflammatory response that curtails bacterial growth during invasive skin infection. However, the cleavage of IL-1 beta by SpeB has a dual role, promoting streptococcal infection of the nasopharynx by disrupting colonization resistance mediated by the microbiota.
Verified Bioactivity
1.Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is <10 pg/mL. The specific activity of recombinant human IL-1 beta is approximately >1.5 x 108 IU/mg.
2.Measure by its ability to induce IL-8 secretion in HT29 cells. The ED50 for this effect is ≤5.1 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P01584 (A117-S269)
-
Molecular Construction
-
N-term
-
IL-1β (A117-S269)
Accession # P01584 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL1B; IL-1B; Interleukin 1 Beta; Multifunctional Fusion Protein; IL1F2; Pro-Interleukin-1-Beta; Interleukin-1 Beta; Preinterleukin 1 Beta; IL1-BETA; Interleukin 1beta; IL-1 Beta; IL1beta; Catabolin; IL-1
-
AA Sequence
MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
-
Predicted Molecular Mass
18.5 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)