Animal-Free IL-1 beta Protein, Human (His)

IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. Animal-Free IL-1 beta Protein, Human (His) is the recombinant human-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-1 beta Protein, Human (His) is 153 a.a., with molecular weight of ~18.48 kDa.

IL-1 beta Protein stands as a potent pro-inflammatory cytokine, recognized for its diverse roles in orchestrating immune responses. Originally identified as a major endogenous pyrogen, IL-1 beta induces a cascade of inflammatory events, including prostaglandin synthesis, neutrophil influx and activation, T-cell and B-cell activation, cytokine production, as well as fibroblast proliferation and collagen production. It plays a pivotal role in immune cell differentiation, promoting Th17 differentiation of T-cells and synergizing with IL-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Additionally, IL-1 beta contributes to angiogenesis by inducing VEGF production, working synergistically with TNF and IL-6. Notably, it plays a key role in transducing inflammation downstream of pyroptosis, being specifically released into the extracellular milieu through the gasdermin-D (GSDMD) pore. In the context of microbial infection, IL-1 beta acts as a sensor of S. pyogenes infection in the skin, undergoing cleavage and activation by the pyogenes SpeB protease, leading to an inflammatory response that curtails bacterial growth during invasive skin infection. However, the cleavage of IL-1 beta by SpeB has a dual role, promoting streptococcal infection of the nasopharynx by disrupting colonization resistance mediated by the microbiota.

1.Measure by its ability to induce proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <10 pg/mL. The specific activity of recombinant human IL-1 beta is approximately >1.5 x 10⁸ IU/mg.
2.Measure by its ability to induce IL-8 secretion in HT29 cells. The ED₅₀ for this effect is ≤5.1 ng/mL.

Human

E. coli

C-His

P01584 (A117-S269)

3553  [NCBI]

MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Approximately 18.48 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.