Animal-Free IL-2 Protein, Pig (His)

Customer Review

Based on 1 Customer Validation

IL-2 is produced by antigen-activated CD4+ T cells, CD8+ T cells, NK cells and NKT cells. IL-2 is involved in signaling pathways including JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 can be used in the research of cancer immunotherapy. Animal-Free IL-2 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Pig
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-2 is produced by antigen-activated CD4+ T cells, CD8+ T cells, NK cells and NKT cells. IL-2 is involved in signaling pathways including JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 can be used in the research of cancer immunotherapy. Animal-Free IL-2 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-2 is a receptor cytokine produced by activated CD4-positive helper T cells and plays its role by activating JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 binds to receptor complexes consisting of high affinity trimers IL-2R (IL2RA/CD25, IL2RB/CD122 and IL2RG/CD132) or low affinity dimers IL-2R (IL2RB and IL2RG). IL-2 can increase the cytolytic activity of NK cells. Promote strong proliferation of activated B cells and immunoglobulin production. IL-2 is involved in the differentiation and homeostasis of effector T cell subsets, including Th1, Th2, Th17, and memory CD8-positive T cells. IL-2 synthesis is strictly regulated by TCR and CD28 signaling at the mRNA level. It mediates the activation-induced cell death (AICD) process. IL-2 can be used in the research of cancer immunotherapy[1][2][3][4].

Verified Bioactivity

Measure by its ability to induce proliferation in CTLL2 cells. The ED50 for this effect is < 0.5 ng/mL.

Technical Parameters

  • Species Pig
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-2 (A21-T154)
      Accession # P26891
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL2; T Cell Growth Factor; Interleukin 2; Aldesleukin; IL-2; Involved In Regulation Of T-Cell Clonal Expansion; TCGF; T-Cell Growth Factor; Interleukin-2; Lymphokine

  • AA Sequence

    APTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT

  • Predicted Molecular Mass

    16.2 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00