Animal-Free IL-2 Protein, Pig (His)
Based on 1 Customer Validation
IL-2 is produced by antigen-activated CD4+ T cells, CD8+ T cells, NK cells and NKT cells. IL-2 is involved in signaling pathways including JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 can be used in the research of cancer immunotherapy. Animal-Free IL-2 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Species: Pig
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-2 is produced by antigen-activated CD4+ T cells, CD8+ T cells, NK cells and NKT cells. IL-2 is involved in signaling pathways including JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 can be used in the research of cancer immunotherapy. Animal-Free IL-2 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Background
IL-2 is a receptor cytokine produced by activated CD4-positive helper T cells and plays its role by activating JAK/STAT, inosine phosphate 3-kinase /PI3K and mitogen-activated protein kinase /MAPK. IL-2 binds to receptor complexes consisting of high affinity trimers IL-2R (IL2RA/CD25, IL2RB/CD122 and IL2RG/CD132) or low affinity dimers IL-2R (IL2RB and IL2RG). IL-2 can increase the cytolytic activity of NK cells. Promote strong proliferation of activated B cells and immunoglobulin production. IL-2 is involved in the differentiation and homeostasis of effector T cell subsets, including Th1, Th2, Th17, and memory CD8-positive T cells. IL-2 synthesis is strictly regulated by TCR and CD28 signaling at the mRNA level. It mediates the activation-induced cell death (AICD) process. IL-2 can be used in the research of cancer immunotherapy[1][2][3][4].
Verified Bioactivity
Measure by its ability to induce proliferation in CTLL2 cells. The ED50 for this effect is < 0.5 ng/mL.
Technical Parameters
-
Species Pig
-
Source E. coli
-
Tag C-6*His
-
Accession
P26891 (A21-T154)
-
Molecular Construction
-
N-term
-
IL-2 (A21-T154)
Accession # P26891 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL2; T Cell Growth Factor; Interleukin 2; Aldesleukin; IL-2; Involved In Regulation Of T-Cell Clonal Expansion; TCGF; T-Cell Growth Factor; Interleukin-2; Lymphokine
-
AA Sequence
APTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT
-
Predicted Molecular Mass
16.2 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. G Reya T, et al. Thymic stromal-cell abnormalities and dysregulated T-cell development in IL-2-deficient mice. Dev Immunol. 1998;5(4):287-302. [Content Brief]
[2]. Zhu J, et al. Stat5 activation plays a critical role in Th2 differentiation. Immunity. 2003 Nov;19(5):739-48. [Content Brief]
[3]. Smith GA, et al. Essential biphasic role for JAK3 catalytic activity in IL-2 receptor signaling. Nat Chem Biol. 2016 May;12(5):373-9. [Content Brief]
[4]. Sim GC, et al. The IL-2 cytokine family in cancer immunotherapy. Cytokine Growth Factor Rev. 2014 Aug;25(4):377-90. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
