Animal-Free TGF beta 2/TGFB2 Protein, Human (His)

In the TGF-beta-2 pathway, TGF beta 2/TGFB2 protein acts as a precursor for Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF beta 2/TGFB2 maintains TGF-beta-2 in a latent state within the extracellular matrix, forming non-covalent associations with TGF-beta-2. Interactions with 'milieu molecules' like LTBP1 and LRRC32/GARP finely tune TGF-beta-2 activation, playing a pivotal role in controlling this critical signaling pathway. Animal-Free TGF beta 2/TGFB2 Protein, Human (His) is the recombinant human-derived animal-FreeTGF beta 2/TGFB2 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free TGF beta 2/TGFB2 Protein, Human (His) is 112 a.a., with molecular weight of ~13.66 kDa.

As a central player in the TGF-beta-2 signaling pathway, the TGF beta 2/TGFB2 protein assumes the role of a precursor for both the Latency-associated peptide (LAP) and the Transforming growth factor beta-2 (TGF-beta-2) chains. These chains collectively form the regulatory and active subunits of TGF-beta-2, respectively. Notably, TGF beta 2/TGFB2 is essential for maintaining the TGF-beta-2 chain in a latent state during storage within the extracellular matrix. The protein engages in non-covalent associations with TGF-beta-2, intricately regulating its activation through interactions with 'milieu molecules,' including LTBP1 and LRRC32/GARP. These interactions play a pivotal role in controlling the activation of TGF-beta-2, contributing to the finely tuned regulation of this critical signaling pathway.

Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED₅₀ for this effect is <0.2 ng/mL. The specific activity of recombinant human TGF beta 2 is >5 x 10⁶ IU/mg.

Human

E. coli

C-His

P61812 (A303-S414)

7042  [NCBI]

MALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Approximately 13.66 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

<0.01 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.