Animal-Free TGF beta 2/TGFB2 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

In the TGF-beta-2 pathway, the TGF beta 2/TGFB2 protein serves as a precursor to latency-associated peptide (LAP) and transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF-β2/TGFB2 maintains TGF-β-2 in a latent state within the extracellular matrix, forming a non-covalent association with TGF-β-2. Animal-Free TGF beta 2/TGFB2 Protein, Human (His) is the recombinant human-derived animal-FreeTGF beta 2/TGFB2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

In the TGF-beta-2 pathway, the TGF beta 2/TGFB2 protein serves as a precursor to latency-associated peptide (LAP) and transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF-β2/TGFB2 maintains TGF-β-2 in a latent state within the extracellular matrix, forming a non-covalent association with TGF-β-2. Animal-Free TGF beta 2/TGFB2 Protein, Human (His) is the recombinant human-derived animal-FreeTGF beta 2/TGFB2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

As a central player in the TGF-beta-2 signaling pathway, the TGF beta 2/TGFB2 protein assumes the role of a precursor for both the Latency-associated peptide (LAP) and the Transforming growth factor beta-2 (TGF-beta-2) chains. These chains collectively form the regulatory and active subunits of TGF-beta-2, respectively. Notably, TGF beta 2/TGFB2 is essential for maintaining the TGF-beta-2 chain in a latent state during storage within the extracellular matrix. The protein engages in non-covalent associations with TGF-beta-2, intricately regulating its activation through interactions with 'milieu molecules,' including LTBP1 and LRRC32/GARP. These interactions play a pivotal role in controlling the activation of TGF-beta-2, contributing to the finely tuned regulation of this critical signaling pathway.

Verified Bioactivity

Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human TGF beta 2 is >5 x 106 IU/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TGFB2 (A303-S414)
      Accession # P61812-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of TGFB2 Chain

  • Synonyms

    TGFB2; Transforming Growth Factor, Beta 2; Transforming Growth Factor Beta 2; BSC-1 Cell Growth Inhibitor; Glioblastoma-Derived T-Cell Suppressor Factor; TGF-Beta2; Transforming Growth Factor Beta-2 Proprotein; Polyergin; Prepro-Transforming Growth Factor

  • AA Sequence

    ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

  • Predicted Molecular Mass

    13.7 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00