Animal-Free VEGF Protein, Pig (His)
The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. Animal-Free VEGF Protein, Pig (His) is the recombinant pig-derived animal-FreeVEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Species: Pig
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. Animal-Free VEGF Protein, Pig (His) is the recombinant pig-derived animal-FreeVEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Background
The VEGF-A Protein, a versatile growth factor, plays a crucial role in angiogenesis, vasculogenesis, and endothelial cell growth. Its diverse effects include inducing endothelial cell proliferation, promoting cell migration, inhibiting apoptosis, and inducing permeabilization of blood vessels. VEGF-A achieves these functions by binding to receptors FLT1/VEGFR1 and KDR/VEGFR2, as well as heparan sulfate and heparin. Notably, its interaction with the NRP1 receptor initiates a signaling pathway essential for motor neuron axon guidance and cell body migration during embryonic development. Additionally, VEGF-A binds to the DEAR/FBXW7-AS1 receptor, further expanding its regulatory roles. Structurally, VEGF-A exists as a homodimer linked by disulfide bonds and can also form heterodimers with PGF. Interactions with NRP1 and BSG underscore the intricate molecular relationships that underlie the multifaceted functions of VEGF-A in orchestrating vascular processes and embryonic development.
Technical Parameters
-
Species Pig
-
Source E. coli
-
Tag C-6*His
-
Accession
P49151 (A27-R190)
-
Molecular Construction
-
N-term
-
VEGF (A27-R190)
Accession # P49151 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G
-
AA Sequence
APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
-
Predicted Molecular Mass
20.2 kDa
-
Molecular Weight
Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
