Copy Link Print Information

Annexin A5/ANXA5 Protein, Mouse (His, Myc)

Customer Review

Based on 1 Customer Validation

The annexin A5 (ANXA5) protein acts as an anticoagulant, indirectly inhibiting the thromboplastin-specific complex, which is critical in the coagulation cascade. As a monomer, ANXA5 plays a key role in regulating the coagulation pathway, affecting the delicate balance between pro- and anti-coagulant factors. Annexin A5/ANXA5 Protein, Mouse (His, Myc) is the recombinant mouse-derived Annexin A5/ANXA5 protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Annexin A5/ANXA5 Protein, Mouse (His, Myc)
  • Annexin A5/ANXA5 Protein, Mouse (His, Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The annexin A5 (ANXA5) protein acts as an anticoagulant, indirectly inhibiting the thromboplastin-specific complex, which is critical in the coagulation cascade. As a monomer, ANXA5 plays a key role in regulating the coagulation pathway, affecting the delicate balance between pro- and anti-coagulant factors. Annexin A5/ANXA5 Protein, Mouse (His, Myc) is the recombinant mouse-derived Annexin A5/ANXA5 protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Background

Annexin A5 (ANXA5) protein serves as an anticoagulant, acting as an indirect inhibitor of the thromboplastin-specific complex crucial in the blood coagulation cascade. Structurally, it exists as a monomer, and in its functional capacity, ANXA5 plays a pivotal role in regulating key components of the coagulation pathway, thereby influencing the delicate balance between procoagulant and anticoagulant factors. Additionally, ANXA5 exhibits binding interactions with ATRX and EIF5B, suggesting its involvement in diverse cellular processes beyond its role in coagulation. These multifaceted attributes underscore the significance of ANXA5 in cellular regulation and its potential implications in both hemostasis and broader cellular functions.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-10*His;C-Myc
  • Accession

    P48036 (A2-D319)

  • Gene ID
    11747
  • Molecular Construction
    • N-term
    • 10*His
    • ANXA5 (A2-D319)
      Accession # P48036
    • Myc
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    ANXA5; RPRGL3; Prev. ANX5; Thromboplastin Inhibitor; Prev. ENX2; Anchorin CII; CPB-I; Lipocortin V; PAP-I; VAC-Alpha; Placental Anticoagulant Protein I; Annexin-5; Vascular Anticoagulant-Alpha; PP4; Calphobindin I; Epididymis Secretory Protein Li 7; Endon

  • AA Sequence

    ATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD

  • Molecular Weight

    Approximately 38-41 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, pH 8.0, 6% trehalose
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Annexin A5/ANXA5 Protein, Mouse (His, Myc) Product Image
    1/16
  • Experimental Validation Results for Annexin A5/ANXA5 Protein, Mouse (His, Myc)
  • Annexin A5/ANXA5 Protein, Mouse (His, Myc) Product Image