APE Protein, Human
Based on 1 publication(s) in Google Scholar
APE Protein, Human is an approximately 40.0 kDa protein expressed by E. coli expression system. Human APE plays an important role in BER by acting downstream of DNA glycosylases.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
APE Protein, Human is an approximately 40.0 kDa protein expressed by E. coli expression system. Human APE plays an important role in BER by acting downstream of DNA glycosylases[1].
Background
Human APE is a 36-kDa multifunctional protein that performs essential functions in DNA repair, transcription, RNA biogenesis, and cell proliferation. Additionally, DNA substrate specificity of APE1 is modulated by concentrations of divalent cations, pH, and ionic strength in an apparently allosteric manner[1].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Nanobiotechnology
Virosome-masked ratiometric nanoprobes for in vivo dynamic imaging of influenza a virus infection. [Abstract]2026 Jul 21. PMID: 42482242
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P27695 (P2-L318)
-
Molecular Construction
-
N-term
-
APE (P2-L318)
Accession # P27695 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
APEX1; APE1; Prev. APEX; DNA-(Apurinic Or Apyrimidinic Site) Endonuclease; APEN; APEX Nuclease; REF-1; APEX Nuclease (Multifunctional DNA Repair Enzyme); REF1; Deoxyribonuclease (Apurinic Or Apyrimidinic); HAP1; Apurinic/Apyrimidinic (Abasic) Endonuclease
-
AA Sequence
PKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
-
Predicted Molecular Mass
35.6 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 10 mM HEPES, 100 mM KCl, 50% glycerol, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
