APLN/Apelin Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

APLN/Apelin protein is the endogenous ligand of APLNR and drives APLNR internalization. APLN/Apelin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived APLN/Apelin protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

APLN/Apelin protein is the endogenous ligand of APLNR and drives APLNR internalization. APLN/Apelin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived APLN/Apelin protein, expressed by HEK293 , with C-hFc labeled tag.

Background

APLN/Apelin Protein serves as the endogenous ligand for the apelin receptor (APLNR), actively driving the internalization of APLNR. Notably, APLN exhibits distinct dissociation characteristics, with apelin-36 showing greater resistance to dissociation than (pyroglu)apelin-13 from APLNR. Beyond its role as a ligand, APLN plays a pivotal role in various physiological processes, including the regulation of cardiac precursor cell movements during gastrulation and heart morphogenesis. Additionally, it exerts an inhibitory effect on cytokine production in response to T-cell receptor/CD3 cross-linking, suggesting a potential modulatory role in immune responses, especially in neonates through oral intake in colostrum and milk. APLN contributes to the early formation of coronary blood vessels and mediates myocardial contractility in an ERK1/2-dependent manner. Furthermore, it may have a role in the central control of body fluid homeostasis by influencing vasopressin release and drinking behavior. The multifaceted functions of APLN highlight its significance in diverse physiological processes and potential therapeutic implications.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • APLN (V23-F77)
      Accession # Q9R0R4
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    APLN; APEL; Apelin; Apelin, AGTRL1 Ligand; XNPEP2; AGTRL1 Ligand; APJ Endogenous Ligand

  • AA Sequence

    VPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF

  • Predicted Molecular Mass

    33 kDa

  • Molecular Weight

    Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 200 mM Arginine, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00