APLN/Apelin Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
APLN/Apelin protein is the endogenous ligand of APLNR and drives APLNR internalization. APLN/Apelin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived APLN/Apelin protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
APLN/Apelin protein is the endogenous ligand of APLNR and drives APLNR internalization. APLN/Apelin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived APLN/Apelin protein, expressed by HEK293 , with C-hFc labeled tag.
Background
APLN/Apelin Protein serves as the endogenous ligand for the apelin receptor (APLNR), actively driving the internalization of APLNR. Notably, APLN exhibits distinct dissociation characteristics, with apelin-36 showing greater resistance to dissociation than (pyroglu)apelin-13 from APLNR. Beyond its role as a ligand, APLN plays a pivotal role in various physiological processes, including the regulation of cardiac precursor cell movements during gastrulation and heart morphogenesis. Additionally, it exerts an inhibitory effect on cytokine production in response to T-cell receptor/CD3 cross-linking, suggesting a potential modulatory role in immune responses, especially in neonates through oral intake in colostrum and milk. APLN contributes to the early formation of coronary blood vessels and mediates myocardial contractility in an ERK1/2-dependent manner. Furthermore, it may have a role in the central control of body fluid homeostasis by influencing vasopressin release and drinking behavior. The multifaceted functions of APLN highlight its significance in diverse physiological processes and potential therapeutic implications.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9R0R4 (V23-F77)
-
Molecular Construction
-
N-term
-
APLN (V23-F77)
Accession # Q9R0R4 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APLN; APEL; Apelin; Apelin, AGTRL1 Ligand; XNPEP2; AGTRL1 Ligand; APJ Endogenous Ligand
-
AA Sequence
VPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
-
Predicted Molecular Mass
33 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 200 mM Arginine, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)