1. Recombinant Proteins
  2. Others
  3. APLN/Apelin Protein, Mouse (HEK293, Fc)

APLN/Apelin protein is the endogenous ligand of APLNR and drives APLNR internalization. APLN/Apelin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived APLN/Apelin protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

APLN/Apelin protein is the endogenous ligand of APLNR and drives APLNR internalization. APLN/Apelin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived APLN/Apelin protein, expressed by HEK293 , with C-hFc labeled tag.

Background

APLN/Apelin Protein serves as the endogenous ligand for the apelin receptor (APLNR), actively driving the internalization of APLNR. Notably, APLN exhibits distinct dissociation characteristics, with apelin-36 showing greater resistance to dissociation than (pyroglu)apelin-13 from APLNR. Beyond its role as a ligand, APLN plays a pivotal role in various physiological processes, including the regulation of cardiac precursor cell movements during gastrulation and heart morphogenesis. Additionally, it exerts an inhibitory effect on cytokine production in response to T-cell receptor/CD3 cross-linking, suggesting a potential modulatory role in immune responses, especially in neonates through oral intake in colostrum and milk. APLN contributes to the early formation of coronary blood vessels and mediates myocardial contractility in an ERK1/2-dependent manner. Furthermore, it may have a role in the central control of body fluid homeostasis by influencing vasopressin release and drinking behavior. The multifaceted functions of APLN highlight its significance in diverse physiological processes and potential therapeutic implications.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9R0R4 (V23-F77)

Gene ID
Molecular Construction
N-term
APLN (V23-F77)
Accession # Q9R0R4
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Apelin; APJ endogenous ligand; APEL
AA Sequence

VPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF

Predicted Molecular Mass
33 kDa
Molecular Weight

Approximately 35-45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 200 mM Arginine, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

APLN/Apelin Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

APLN/Apelin Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APLN/Apelin Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77563
Quantity:
MCE Japan Authorized Agent: