APLN/Apelin Protein, Human (HEK293, Fc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

APLN protein is an endogenous ligand for the apelin receptor (APLNR), drives receptor internalization, and dissociates more strongly from APLNR than (pyroglu)apelin-13. APLN/Apelin Protein, Human (HEK293, Fc) is the recombinant human-derived APLN protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

APLN protein is an endogenous ligand for the apelin receptor (APLNR), drives receptor internalization, and dissociates more strongly from APLNR than (pyroglu)apelin-13. APLN/Apelin Protein, Human (HEK293, Fc) is the recombinant human-derived APLN protein, expressed by HEK293 , with C-hFc labeled tag.

Background

APLN Protein emerges as the endogenous ligand for the apelin receptor (APLNR), actively participating in the internalization of the receptor. Notably, APLN exhibits differential dissociation characteristics, with apelin-36 dissociating more robustly than (pyroglu)apelin-13 from APLNR. Beyond its role as a ligand, APLN serves diverse physiological functions, influencing cardiac precursor cell movements during gastrulation and heart morphogenesis. Additionally, it has an inhibitory effect on cytokine production in response to T-cell receptor/CD3 cross-linking, suggesting a potential role in modulating immune responses, particularly in neonates through oral intake in colostrum and milk. APLN also contributes to early coronary blood vessel formation and mediates myocardial contractility in an ERK1/2-dependent manner. Furthermore, it may play a role in the central control of body fluid homeostasis by influencing vasopressin release and drinking behavior. In the context of microbial infection, APLN acts as an endogenous ligand for APLNR, serving as an alternative coreceptor with CD4 for HIV-1 infection and exhibiting inhibitory activity on HIV entry in cells coexpressing CD4 and APLNR, with apelin-36 demonstrating greater inhibitory efficacy than other synthetic apelin derivatives.

Verified Bioactivity

1.Immobilized Human APLN, hFc Tag at 0.5 μg/mL (100 μl/Well) on the plate. Dose response curve for Biotinylated Anti-APLN Antibody, hFc Tag with the EC50 of 22.2 ng/mL determined by ELISA.
2.Immobilized Human APLN, hFc Tag at 1 μg/mL(100 μL/Well) on the plate. Dose response curve for Biotinylated Anti-APLN Antibody, hFc Tag with the EC50 of 20.0-60.0 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • APLN (G23-F77)
      Accession # Q9ULZ1
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    APLN; APEL; Apelin; Apelin, AGTRL1 Ligand; XNPEP2; AGTRL1 Ligand; APJ Endogenous Ligand

  • AA Sequence

    GSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

  • Predicted Molecular Mass

    32.9 kDa

  • Molecular Weight

    Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 200 mM Arginine, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00