Apolipoprotein L/APOL1 Protein, Human (sf9, His)

Apolipoprotein L (APOL1) Protein is a member of the apolipoprotein L family. Apolipoprotein L/APOL1 Protein, Human (sf9, His) is the recombinant human-derived Apolipoprotein L/APOL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Apolipoprotein L/APOL1 Protein is a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver.

Human

Sf9 insect cells

C-His

Q2KHQ6 (E28-L398)

8542  [NCBI]

Full Length of Mature Protein

EEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSKLEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTIDYGKKWWTQAQAHDLVIKSLDKLKEVKEFLGENISNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL

Approximately 44 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 80%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20mM Tris, 300mM NaCl, pH 7.5,10% Glycerol，0.5mM TCEP.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.