Apolipoprotein L/APOL1 Protein, Human (sf9, His)
Apolipoprotein L (APOL1) Protein is a member of the apolipoprotein L family. Apolipoprotein L/APOL1 Protein, Human (sf9, His) is the recombinant human-derived Apolipoprotein L/APOL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Apolipoprotein L (APOL1) Protein is a member of the apolipoprotein L family. Apolipoprotein L/APOL1 Protein, Human (sf9, His) is the recombinant human-derived Apolipoprotein L/APOL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Apolipoprotein L/APOL1 Protein is a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q2KHQ6 (E28-L398)
-
Molecular Construction
-
N-term
-
APOL1 (E28-L398)
Accession # Q2KHQ6 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APOL1; Apolipoprotein L 1; Prev. APOL; APOL1 Protein; Apolipoprotein L1-B3; APOL-I; Apolipoprotein L; ApoL-I; CDNA FLJ59906, Moderately Similar To Apolipoprotein-L1; FSGS4; Apolipoprotein L 1 Isoform 2; APO-L; Apolipoprotein L 1 Isoform 1; Apo-L; Alternat
-
AA Sequence
EEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSKLEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTIDYGKKWWTQAQAHDLVIKSLDKLKEVKEFLGENISNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL
-
Predicted Molecular Mass
42.5 kDa
-
Molecular Weight
Approximately 44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
