Ara h 2 Protein, Arachis hypogaea (His)
Based on 1 Customer Validation
Ara h 2 Protein, Arachis hypogaea (His) is the recombinant Ara h 2 protein, expressed by E. coli, with N-6*His tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Ara h 2 Protein, Arachis hypogaea (His) is the recombinant Ara h 2 protein, expressed by E. coli, with N-6*His tag.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
Q6PSU2-1 (R22-Y172)
-
Gene ID112771110
-
Molecular Construction
-
N-term
-
6*His
-
Ara h 2 (R22-Y172)
Accession # Q6PSU2-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
Conglutin-7; 2S protein 1; Seed storage protein SSP1; Seed storage protein SSP2 ; Ara h 2
-
AA Sequence
RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
-
Predicted Molecular Mass
22.0 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
