araA Protein, Geobacillus stearothermophilus (His)
araA protein, a key component, facilitates the conversion of L-arabinose to L-ribulose. Furthermore, in vitro experiments reveal its capability to convert D-galactose to D-tagatose. araA Protein, Geobacillus stearothermophilus (His) is the recombinant araA protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
araA protein, a key component, facilitates the conversion of L-arabinose to L-ribulose. Furthermore, in vitro experiments reveal its capability to convert D-galactose to D-tagatose. araA Protein, Geobacillus stearothermophilus (His) is the recombinant araA protein, expressed by E. coli , with N-6*His labeled tag.
Background
The araA protein plays a vital role in catalyzing the conversion of L-arabinose into L-ribulose. Additionally, it demonstrates the ability to convert D-galactose into D-tagatose when tested in vitro.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9S467 (M1-R496)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
araA (M1-R496)
Accession # Q9S467 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
L-arabinose isomerase; EC:5.3.1.4; araA
-
AA Sequence
MLSLRPYEFWFVTGSQHLYGEEALKQVEEHSMMIVNELNQDSVFPFPLVFKSVVTTPEEIRRVCLEANASEQCAGVITWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAFAESRNLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGIGDLVQYIRDVSEQKVNELLDEYEELYDIVPAGRQEGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHLEPGNEMILGAHMLEVCPTIAATRPRIEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQLQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRGR
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
