ART4/CD297 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
ART4/CD297 is a predicted NAD+ ADP-ribosyltransferase that exhibits biased expression in tissues such as the adrenal gland and thymus. As an ortholog of human ART4, it is involved in peptidyl arginine ADP ribosylation. ART4/CD297 Protein, Rat (HEK293, His) is the recombinant rat-derived ART4/CD297 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ART4/CD297 is a predicted NAD+ ADP-ribosyltransferase that exhibits biased expression in tissues such as the adrenal gland and thymus. As an ortholog of human ART4, it is involved in peptidyl arginine ADP ribosylation. ART4/CD297 Protein, Rat (HEK293, His) is the recombinant rat-derived ART4/CD297 protein, expressed by HEK293 , with C-His labeled tag.
Background
ART4/CD297, a predicted NAD+ ADP-ribosyltransferase, is implicated in peptidyl-arginine ADP-ribosylation. As an ortholog to human ART4 (ADP-ribosyltransferase 4 (inactive) (Dombrock blood group)), this protein exhibits biased expression in tissues such as the adrenal gland, thymus, and six other tissues. The prediction of NAD+ ADP-ribosyltransferase activity underscores its potential role in post-translational modification processes, particularly in the context of peptidyl-arginine ADP-ribosylation, contributing to the functional diversity of this enzyme.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
F1MA10/NP_001166980 (G30-K269)
-
Molecular Construction
-
N-term
-
ART4 (G30-K269)
Accession # F1MA10/NP_001166980 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
ART4; Dombrock Blood Group Carrier Molecule Splice Variant III; Prev. DO; NAD(P)(+)--Arginine ADP-Ribosyltransferase; ARTC4; Mono(ADP-Ribosyl)Transferase 4; DOK1; Mono-ADP-Ribosyltransferase 4; ADP-Ribosyltransferase 4 (Dombrock Blood Group); Mono(ADP-Rib
-
AA Sequence
GSAEAALKVDVDLTPGSFDDQYRGCSKQVLEELNQGDYFVREIDTHKYYSRAWQKAHLTWLNQATSLPESMTPVHAVAILVFTLNLNVSSDFAKAMTRASGSPGQYRQSFHFKYLHYYLTSAIQLLRKESSTKNGSPCYRVHHRMKDVNIEANVGSTVRFGQFLSASLLKEETQVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKNCSLKGDLINLRSAGNVSRYNCQLLK
-
Molecular Weight
Approximately 36-41 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
