Arylsulfatase B/ARSB Protein, Human (His-SUMO)

The arylsulfatase B (ARSB) protein is critical for cellular homeostasis by removing the sulfate group from chondroitin 4-sulfate (C4S), thereby directing its degradation. Its enzymatic activity affects the adhesion, migration and invasion of colon epithelial cells. Arylsulfatase B/ARSB Protein, Human (His-SUMO) is the recombinant human-derived Arylsulfatase B/ARSB, expressed by E. coli Cell-free, with N-SUMO, N-6*His labeled tag. The total length of Arylsulfatase B/ARSB Protein, Human (His-SUMO) is 497 a.a..

Arylsulfatase B (ARSB) protein plays a crucial role in the maintenance of cellular homeostasis by removing sulfate groups from chondroitin-4-sulfate (C4S) and orchestrating its degradation. This enzymatic activity extends its influence to various cellular processes, including the regulation of cell adhesion, migration, and invasion within the colonic epithelium. Beyond its involvement in the gastrointestinal system, ARSB emerges as a key regulator in the central nervous system, where it modulates neurite outgrowth and neuronal plasticity. This regulatory function is executed through the control of sulfate glycosaminoglycans and neurocan levels, highlighting the multifaceted impact of ARSB in maintaining the structural and functional integrity of cells in different tissues.

Human

E. coli

N-SUMO;N-6*His

P15848-1 (S37-M533)

411

Full Length of Isoform-1 Mature Protein

SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.