Arylsulfatase B/ARSB Protein, Human (P.pastoris, His)
The arylsulfatase B (ARSB) protein is critical for cellular homeostasis by removing the sulfate group from chondroitin 4-sulfate (C4S), thereby directing its degradation. Its enzymatic activity affects the adhesion, migration and invasion of colon epithelial cells. Arylsulfatase B/ARSB Protein, Human (P.pastoris, His) is the recombinant human-derived Arylsulfatase B/ARSB, expressed by P. pastoris, with N-6*His labeled tag. The total length of Arylsulfatase B/ARSB Protein, Human (P.pastoris, His) is 497 a.a..
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The arylsulfatase B (ARSB) protein is critical for cellular homeostasis by removing the sulfate group from chondroitin 4-sulfate (C4S), thereby directing its degradation. Its enzymatic activity affects the adhesion, migration and invasion of colon epithelial cells. Arylsulfatase B/ARSB Protein, Human (P.pastoris, His) is the recombinant human-derived Arylsulfatase B/ARSB, expressed by P. pastoris, with N-6*His labeled tag. The total length of Arylsulfatase B/ARSB Protein, Human (P.pastoris, His) is 497 a.a..
Background
Arylsulfatase B (ARSB) protein plays a crucial role in the maintenance of cellular homeostasis by removing sulfate groups from chondroitin-4-sulfate (C4S) and orchestrating its degradation. This enzymatic activity extends its influence to various cellular processes, including the regulation of cell adhesion, migration, and invasion within the colonic epithelium. Beyond its involvement in the gastrointestinal system, ARSB emerges as a key regulator in the central nervous system, where it modulates neurite outgrowth and neuronal plasticity. This regulatory function is executed through the control of sulfate glycosaminoglycans and neurocan levels, highlighting the multifaceted impact of ARSB in maintaining the structural and functional integrity of cells in different tissues.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P15848-1 (S37-M533)
-
Gene ID411
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ARSB; N-Acetylgalactosamine-4-Sulfatase; Arylsulfatase B; G4S; ASB; MPS6
-
AA Sequence
SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
-
Predicted Molecular Mass
58 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
