1. Recombinant Proteins
  2. Receptor Proteins Biotinylated Proteins
  3. ASGR1/ASGPR1 Protein, Mouse (Biotinylated, HEK293, His)

ASGR1/ASGPR1 Protein, Mouse (Biotinylated, HEK293, His)

Cat. No.: HY-P77555
Handling Instructions Technical Support

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
100 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

ASGR1/ASGPR1 proteins play a crucial role in cellular processes by mediating endocytosis of desialylated plasma glycoproteins and recognizing terminal galactose and N-acetylgalactosamine. It promotes ligand internalization and formation of complexes that are transported to sorting organelles. ASGR1/ASGPR1 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived ASGR1/ASGPR1 protein, expressed by HEK293 , with N-His labeled tag.

Background

ASGR1/ASGPR1 Protein assumes a crucial role in cellular processes by mediating the endocytosis of plasma glycoproteins whose terminal sialic acid residue on complex carbohydrate moieties has been removed. The receptor's recognition of terminal galactose and N-acetylgalactosamine units enables the internalization of ligands, forming a complex that is subsequently transported to a sorting organelle. Within this organelle, the receptor and ligand disassociate, and ASGR1/ASGPR1 is recycled back to the cell membrane surface. The protein's involvement in these dynamic processes underscores its significance in the cellular handling of glycoproteins and contributes to the regulation of cellular homeostasis. Notably, ASGR1/ASGPR1 also interacts with LASS2, expanding its molecular associations and suggesting potential implications in cellular signaling or coordination.

Species

Mouse

Source

HEK293

Tag

N-His

Accession

P34927 (S60-N284)

Gene ID
Molecular Construction
N-term
His
ASGR1 (S60-N284)
Accession # P34927
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
ASGPR; ASGPR1; ASGR1; Asialoglycoprotein receptor 1; CLEC4H1; Hepatic lectin H1; MHL1
AA Sequence

SQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Predicted Molecular Mass
28 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

ASGR1/ASGPR1 Protein, Mouse (Biotinylated, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

ASGR1/ASGPR1 Protein, Mouse (Biotinylated, HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
ASGR1/ASGPR1 Protein, Mouse (Biotinylated, HEK293, His)
Cat. No.:
HY-P77555
수량:
MCE Japan Authorized Agent: