Copy Link Print Information

ASIP/Agouti Protein, Human (His, Myc)

Customer Review

Based on 1 Customer Validation

ASIP/Agouti proteins tightly regulate melanogenesis by binding to the melanocortin-1 receptor (MC1R), disrupting alpha-melanocyte stimulating hormone (α-MSH) signaling, and inhibiting cyclic AMP (cAMP) production. This down-regulates eumelanin production, shifting pigmentation toward a yellow/red color. ASIP/Agouti Protein, Human (His, Myc) is the recombinant human-derived ASIP/Agouti, expressed by E. coli Cell-free, with C-Myc, N-10*His labeled tag. The total length of ASIP/Agouti Protein, Human (His, Myc) is 110 a.a..

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • ASIP/Agouti Protein, Human (His, Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ASIP/Agouti proteins tightly regulate melanogenesis by binding to the melanocortin-1 receptor (MC1R), disrupting alpha-melanocyte stimulating hormone (α-MSH) signaling, and inhibiting cyclic AMP (cAMP) production. This down-regulates eumelanin production, shifting pigmentation toward a yellow/red color. ASIP/Agouti Protein, Human (His, Myc) is the recombinant human-derived ASIP/Agouti, expressed by E. coli Cell-free, with C-Myc, N-10*His labeled tag. The total length of ASIP/Agouti Protein, Human (His, Myc) is 110 a.a..

Background

The ASIP/Agouti Protein plays a crucial role in the regulation of melanogenesis, exerting its influence by binding to the melanocortin-1 receptor (MC1R). This interaction interferes with the signaling initiated by alpha-melanocyte-stimulating hormone (alpha-MSH), inhibiting the production of cyclic AMP (cAMP). Consequently, there is a down-regulation of eumelanogenesis, responsible for the synthesis of brown/black pigment, and an increase in pheomelanin production, leading to yellow/red pigment synthesis. In higher primates, ASIP/Agouti may impact the quality rather than the pattern of hair pigmentation. Beyond its role in pigmentation, ASIP/Agouti is speculated to play a role in the neuroendocrine aspects of melanocortin action and could potentially influence lipid metabolism in adipocytes. The multifaceted functions of ASIP/Agouti highlight its significance in various physiological processes beyond melanogenesis regulation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-Myc;N-10*His
  • Accession

    P42127 (H23-C132)

  • Gene ID
    434
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    ASIP; Agouti Signaling Protein, Nonagouti Homolog (Mouse); Prev. AGTIL; Agouti (Mouse)-Signaling Protein; ASP; Nonagouti Homolog (Mouse); Agouti-Signaling Protein; Nonagouti Homolog; Agouti Switch Protein; SHEP9; AGTI; AGSW; Agouti Signaling Protein; Agou

  • AA Sequence

    HLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC

  • Predicted Molecular Mass

    19.5 kDa

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ASIP/Agouti Protein, Human (His, Myc) Product Image
    1/16
  • ASIP/Agouti Protein, Human (His, Myc) Product Image