ASIP/Agouti Protein, Human (His, Myc)

ASIP/Agouti proteins tightly regulate melanogenesis by binding to the melanocortin-1 receptor (MC1R), disrupting alpha-melanocyte stimulating hormone (α-MSH) signaling, and inhibiting cyclic AMP (cAMP) production. This down-regulates eumelanin production, shifting pigmentation toward a yellow/red color. ASIP/Agouti Protein, Human (His, Myc) is the recombinant human-derived ASIP/Agouti, expressed by E. coli Cell-free, with C-Myc, N-10*His labeled tag. The total length of ASIP/Agouti Protein, Human (His, Myc) is 110 a.a..

The ASIP/Agouti Protein plays a crucial role in the regulation of melanogenesis, exerting its influence by binding to the melanocortin-1 receptor (MC1R). This interaction interferes with the signaling initiated by alpha-melanocyte-stimulating hormone (alpha-MSH), inhibiting the production of cyclic AMP (cAMP). Consequently, there is a down-regulation of eumelanogenesis, responsible for the synthesis of brown/black pigment, and an increase in pheomelanin production, leading to yellow/red pigment synthesis. In higher primates, ASIP/Agouti may impact the quality rather than the pattern of hair pigmentation. Beyond its role in pigmentation, ASIP/Agouti is speculated to play a role in the neuroendocrine aspects of melanocortin action and could potentially influence lipid metabolism in adipocytes. The multifaceted functions of ASIP/Agouti highlight its significance in various physiological processes beyond melanogenesis regulation.

Human

E. coli

C-Myc;N-10*His

P42127 (H23-C132)

434

Full Length of Mature Protein

HLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.