1. Recombinant Proteins
  2. Others
  3. ASIP/Agouti Protein, Human (His, Myc)

ASIP/Agouti proteins tightly regulate melanogenesis by binding to the melanocortin-1 receptor (MC1R), disrupting alpha-melanocyte stimulating hormone (α-MSH) signaling, and inhibiting cyclic AMP (cAMP) production. This down-regulates eumelanin production, shifting pigmentation toward a yellow/red color. ASIP/Agouti Protein, Human (His, Myc) is the recombinant human-derived ASIP/Agouti, expressed by E. coli Cell-free, with C-Myc, N-10*His labeled tag. The total length of ASIP/Agouti Protein, Human (His, Myc) is 110 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ASIP/Agouti proteins tightly regulate melanogenesis by binding to the melanocortin-1 receptor (MC1R), disrupting alpha-melanocyte stimulating hormone (α-MSH) signaling, and inhibiting cyclic AMP (cAMP) production. This down-regulates eumelanin production, shifting pigmentation toward a yellow/red color. ASIP/Agouti Protein, Human (His, Myc) is the recombinant human-derived ASIP/Agouti, expressed by E. coli Cell-free, with C-Myc, N-10*His labeled tag. The total length of ASIP/Agouti Protein, Human (His, Myc) is 110 a.a..

Background

The ASIP/Agouti Protein plays a crucial role in the regulation of melanogenesis, exerting its influence by binding to the melanocortin-1 receptor (MC1R). This interaction interferes with the signaling initiated by alpha-melanocyte-stimulating hormone (alpha-MSH), inhibiting the production of cyclic AMP (cAMP). Consequently, there is a down-regulation of eumelanogenesis, responsible for the synthesis of brown/black pigment, and an increase in pheomelanin production, leading to yellow/red pigment synthesis. In higher primates, ASIP/Agouti may impact the quality rather than the pattern of hair pigmentation. Beyond its role in pigmentation, ASIP/Agouti is speculated to play a role in the neuroendocrine aspects of melanocortin action and could potentially influence lipid metabolism in adipocytes. The multifaceted functions of ASIP/Agouti highlight its significance in various physiological processes beyond melanogenesis regulation.

Species

Human

Source

E. coli

Tag

C-Myc;N-10*His

Accession

P42127 (H23-C132)

Gene ID

434

Protein Length

Full Length of Mature Protein

Synonyms
Agouti-signaling protein; ASIP; ASP; Agouti switch protein; Agouti Signaling Protein
AA Sequence

HLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC

Predicted Molecular Mass
19.5 kDa
Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ASIP/Agouti Protein, Human (His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ASIP/Agouti Protein, Human (His, Myc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ASIP/Agouti Protein, Human (His, Myc)
Cat. No.:
HY-P702613
Quantity:
MCE Japan Authorized Agent: