Copy Link Print Information

B18R Protein, Vaccinia virus (HEK293, His)

Customer Review

Based on 1 Customer Validation

B18R protein functions as a potent antagonist against the antiviral effects of host IFN-alpha/beta and key IFN-inducible proteins, such as OAS1 involved in viral RNA degradation. It acts as a soluble IFN-alpha receptor, effectively impeding the interaction between host IFN-alpha and its receptor. The protein's ability to interact with host IFNA1 underscores its role in modulating the host's immune response against viral infections. B18R Protein, Vaccinia virus (HEK293, His) is the recombinant Virus-derived B18R protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for B18R Protein, Vaccinia virus (HEK293, His)
  • Experimental Validation Results for B18R Protein, Vaccinia virus (HEK293, His)
  • B18R Protein, Vaccinia virus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

B18R protein functions as a potent antagonist against the antiviral effects of host IFN-alpha/beta and key IFN-inducible proteins, such as OAS1 involved in viral RNA degradation. It acts as a soluble IFN-alpha receptor, effectively impeding the interaction between host IFN-alpha and its receptor. The protein's ability to interact with host IFNA1 underscores its role in modulating the host's immune response against viral infections. B18R Protein, Vaccinia virus (HEK293, His) is the recombinant Virus-derived B18R protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The B18R protein functions as a potent antagonist against the antiviral effects induced by host IFN-alpha/beta and key IFN-inducible proteins, including the host OAS1 involved in viral RNA degradation. Acting as a soluble IFN-alpha receptor, B18R inhibits the interaction between host IFN-alpha and its receptor. This interference in the IFN-alpha signaling pathway serves to counteract the host's innate immune response against viral infections. Notably, B18R achieves its inhibitory effects by interacting with host IFNA1. The multifaceted actions of B18R underscore its role as a viral immune evasion strategy, highlighting its importance in modulating the host's antiviral defenses.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized IFN-α1a at 2 μg/mL (100 μL/well) can bind Vaccinia virus B18R. The ED50 for this effect is 9.681 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized IFN-α1a at 2 μg/mL (100 μL/well) can bind Vaccinia virus B18R. The ED50 for this effect is 9.681 ng/mL.

Technical Parameters

  • Species Virus
  • Source HEK293
  • Tag C-6*His
  • Accession

    P25213 (H20-E351)

  • Gene ID
    3707577  [NCBI]
  • Molecular Construction
    • N-term
    • B18R (H20-E351)
      Accession # P25213
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    VACWR200; B18R; OPG204; B18; Soluble interferon alpha/beta receptor OPG204

  • AA Sequence

    HSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLE

  • Molecular Weight

    Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized IFN-α1a at 2 μg/mL (100 μL/well) can bind Vaccinia virus B18R. The ED50 for this effect is 9.681 ng/mL.

  • B18R Protein, Vaccinia virus (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for B18R Protein, Vaccinia virus (HEK293, His)
  • Experimental Validation Results for B18R Protein, Vaccinia virus (HEK293, His)
  • B18R Protein, Vaccinia virus (HEK293, His) Product Image