Copy Link Print Information

B7-1/CD80 Protein, Macaca nemestrina (HEK293, His)

Customer Review

Based on 1 Customer Validation

B7-1/CD80 Protein is pivotal in providing the costimulatory signal crucial for T lymphocyte activation. T-cell proliferation and cytokine production hinge on the binding of CD28 or CTLA-4 to this receptor. As a crucial immune response mediator, B7-1/CD80 facilitates dynamic interplay between T cells and regulatory receptors, influencing essential processes for T lymphocyte activation and regulation in the immune system. B7-1/CD80 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for B7-1/CD80 Protein, Macaca nemestrina (HEK293, His)
  • Experimental Validation Results for B7-1/CD80 Protein, Macaca nemestrina (HEK293, His)
  • B7-1/CD80 Protein, Macaca nemestrina (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

B7-1/CD80 Protein is pivotal in providing the costimulatory signal crucial for T lymphocyte activation. T-cell proliferation and cytokine production hinge on the binding of CD28 or CTLA-4 to this receptor. As a crucial immune response mediator, B7-1/CD80 facilitates dynamic interplay between T cells and regulatory receptors, influencing essential processes for T lymphocyte activation and regulation in the immune system. B7-1/CD80 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-His labeled tag.

Background

The B7-1/CD80 Protein plays a pivotal role in the costimulatory signal necessary for the activation of T lymphocytes. The induction of T-cell proliferation and cytokine production is contingent upon the binding of CD28 or CTLA-4 to this receptor. As a crucial mediator of immune responses, B7-1/CD80 facilitates the dynamic interplay between T cells and their regulatory receptors, thereby influencing key processes essential for the activation and regulation of T lymphocytes in the immune system.

Verified Bioactivity

Measured by its ability to induce IL-2 secretion by Jurkat human acute T cell leukemia cells. The ED50 for this effect is 1.649 μg/mL. Corresponding to a specific activity is 606.428 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IL-2 secretion by Jurkat human acute T cell leukemia cells. The ED50 for this effect is 1.649 μg/mL. Corresponding to a specific activity is 606.428 U/mg.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-6*His
  • Accession

    O77684/AAC31555 (V35-N242)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • B7-1 (V35-N242)
      Accession # O77684/AAC31555
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD80; B-Lymphocyte Activation Antigen B7; Prev. CD28LG1; LAB7; Prev. CD28LG; BB1; T-Lymphocyte Activation Antigen CD80; B7; Activation B7-1 Antigen; Costimulatory Molecule Variant IgV-CD80; B7.1; Costimulatory Factor CD80; B7-1; CD80 Molecule; CD80 Antige

  • AA Sequence

    VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDN

  • Molecular Weight

    Approximately 35-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce IL-2 secretion by Jurkat human acute T cell leukemia cells. The ED50 for this effect is 1.649 μg/mL. Corresponding to a specific activity is 606.428 U/mg.

  • B7-1/CD80 Protein, Macaca nemestrina (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for B7-1/CD80 Protein, Macaca nemestrina (HEK293, His)
  • Experimental Validation Results for B7-1/CD80 Protein, Macaca nemestrina (HEK293, His)
  • B7-1/CD80 Protein, Macaca nemestrina (HEK293, His) Product Image