B7-2/CD86 Protein, Human (HEK293, hFc, MALS verified)
Based on 1 Customer Validation
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Background
CD86 is a transmembrane region, and a longer cytoplasmic domain than CD80. CD86 is constitutively expressed on interdigitating dendritic cells (DCs), Langerhans cells, peripheral blood DCs, memory B cells and germinal center B cells, and macrophages. CD86 is rapidly upregulated on B cells following activation by cross-linking of the Ig receptor or the addition of a variety of cytokines[1].
Verified Bioactivity
1.Immobilized Human B7-2 at 5 μg/mL (100 μL/well) can bind Biotinylated Human CTLA-4 (HY-P78890). The ED50 for this effect is 15.19 ng/mL.
2.Immobilized Biotinylated Mouse CD28 (HY-P704990) at 1 μg/mL (100 μL/well) on Streptavidin precoated (0.5 μg/well) plate can bind Human B7-2. The ED50 for this effect is 9.828 ng/mL.
3.Human B7-2 Protein Immobilized on Protein A Chip can bind CD28 (HY-P70486) Protein with an affinity constant of 14.6 μM as determined in SPR assay.
4.Human B7-2 Protein Immobilized on Protein A Chip can bind Human CTLA-4 (HY-P70684) with an affinity constant of 3.88 nM as determined in SPR assay.
5.Flow Cytometry assay shows that Human B7-2 can bind to CD28 expressed on Jurkat. The concentration of B7-2 used is 2 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
AAH40261 (L26-P247)
-
Gene ID942
-
Molecular Construction
-
N-term
-
B7-2 (L26-P247)
Accession # AAH40261 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD86; FUN-1; Prev. CD28LG2; B70; T-Lymphocyte Activation Antigen CD86; B-Lymphocyte Activation Antigen B7-2; B7.2; B-Lymphocyte Antigen B7-2; B7-2; CD86 Antigen; CD86 Antigen (CD28 Antigen Ligand 2, B7-2 Antigen); CD86 V6; CTLA-4 Counter-Receptor B7.2; LAB72; Activation B7-2 Antigen; CD86 Molecule; BU63
-
AA Sequence
LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
-
Predicted Molecular Mass
51.4 kDa
-
Molecular Weight
Approximately 70-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation. Approximately 120-150 kDa, verified by SEC-MALS.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.; ≥ 90%, as determined by MALS.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 100 mM Glycine, 25 mM Arginine, 10 mM NaCl, pH 7.5, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<0.01 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
