B7-H6 Protein, Rat (HEK293, Fc)
B7-H6, a distinctive monomeric protein, uniquely triggers NCR3-dependent natural killer (NK) cell activation, specifically interacting with NCR3 while avoiding engagement with other NK cell-activating receptors (NCR1, NCR2, and KLRK1). This specificity underscores B7-H6's unique role in initiating NK cell responses through the NCR3 pathway within the intricate network of NK cell activation mechanisms. B7-H6 Protein, Rat (HEK293, Fc) is the recombinant rat-derived B7-H6 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
B7-H6, a distinctive monomeric protein, uniquely triggers NCR3-dependent natural killer (NK) cell activation, specifically interacting with NCR3 while avoiding engagement with other NK cell-activating receptors (NCR1, NCR2, and KLRK1). This specificity underscores B7-H6's unique role in initiating NK cell responses through the NCR3 pathway within the intricate network of NK cell activation mechanisms. B7-H6 Protein, Rat (HEK293, Fc) is the recombinant rat-derived B7-H6 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
B7-H6, a distinctive protein, serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors, such as NCR1, NCR2, and KLRK1. This interaction highlights its unique role in initiating NK cell responses through the NCR3 pathway, showcasing its specificity in the intricate network of NK cell activation mechanisms.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
XP_006223356 (M1-S308)
-
Molecular Construction
-
N-term
-
B7-H6 (M1-S308)
Accession # XP_006223356 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
NCR3LG1; B7 Homolog 6; Natural Killer Cell Cytotoxicity Receptor 3 Ligand 1; Natural Cytotoxicity Triggering Receptor 3 Ligand 1; B7-H6; B7H6; DKFZp686O24166; Putative Ig-Like Domain-Containing Protein DKFZp686O24166/DKFZp686I21167
-
AA Sequence
MASQSCQRGPENAHMHPKGPCCSALCFLCSLGSSPHGSSLGPLRKCGRRSKPVQSSPEGSRVAEWPDGLLSLLLLLWSLLPSAGGLELEMAGTTQIVFLHEDVTIPCKILGSLHLDLSIVGVIWSLKKDGDESEVFKFYGDQLEAVRPGANVSLLGLEHGDASLYLPRFELWEAGEYQCKVVVTPEKKEGTTRLEVVAHPNMSLSEKPATARGGKEKLIICQLDGFYPEALDIKWMGSALKDSHFQEITEGVVTGPTVKNDDGTFSVTSSLALKPALEDHMYQCVVWHRSWLMPQSLNVTVFENKPRS
-
Predicted Molecular Mass
60.4 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
