BAFF/TNFSF13B Protein, Cynomolgus (HEK293, hFc)

BAFF/TNFSF13B Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived BAFF/TNFSF13B protein, expressed by HEK293, with N-hFc tag.

The BAFF/TNFSF13B protein belongs to the tumor necrosis factor (TNF) family, a group of cytokines involved in regulating immune responses and cell survival. BAFF/TNFSF13B, also known as B-cell activating factor, plays a crucial role in B-cell development, activation, and survival. It binds to its receptors, including BAFF receptor (BAFF-R), and promotes B-cell proliferation, antibody production, and the maintenance of mature B cells. BAFF/TNFSF13B is particularly important in the development and function of the immune system, as it helps to regulate B-cell homeostasis and immune tolerance. Dysregulation of BAFF/TNFSF13B signaling has been implicated in various autoimmune diseases and B-cell malignancies. Understanding the role of BAFF/TNFSF13B in normal physiology and disease pathology can provide valuable insights into potential therapeutic approaches for conditions involving B-cell dysfunction or dysregulation.

1.Measured in a cell proliferation assay using mouse splenocytes. The ED₅₀ for this effect is typically 1-6 ng/mL.
2.Immobilized Cynomolgus Fc-TNFSF13B at 2 μg/ml (100 μl/well) can bind biotinylated Cynomolgus TNFRSF17-Fc, the ED₅₀ of biotinylated Cynomolgus TNFRSF17-Fc is 38ng/ml.

Cynomolgus

HEK293

N-hFc

F7H548 (A134-L285)

693917

Partial

AIQGAEETVIQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

Approximately 47 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, PH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.