BAFF/TNFSF13B Protein, Cynomolgus (HEK293, hFc)
Based on 1 Customer Validation
BAFF/TNFSF13B Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived BAFF/TNFSF13B protein, expressed by HEK293, with N-hFc tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BAFF/TNFSF13B Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived BAFF/TNFSF13B protein, expressed by HEK293, with N-hFc tag.
Background
The BAFF/TNFSF13B protein belongs to the tumor necrosis factor (TNF) family, a group of cytokines involved in regulating immune responses and cell survival. BAFF/TNFSF13B, also known as B-cell activating factor, plays a crucial role in B-cell development, activation, and survival. It binds to its receptors, including BAFF receptor (BAFF-R), and promotes B-cell proliferation, antibody production, and the maintenance of mature B cells. BAFF/TNFSF13B is particularly important in the development and function of the immune system, as it helps to regulate B-cell homeostasis and immune tolerance. Dysregulation of BAFF/TNFSF13B signaling has been implicated in various autoimmune diseases and B-cell malignancies. Understanding the role of BAFF/TNFSF13B in normal physiology and disease pathology can provide valuable insights into potential therapeutic approaches for conditions involving B-cell dysfunction or dysregulation.
Verified Bioactivity
1.Measured in a cell proliferation assay using mouse splenocytes. The ED50 for this effect is typically 1-6 ng/mL.
2.Immobilized Cynomolgus Fc-TNFSF13B at 2 μg/ml (100 μl/well) can bind biotinylated Cynomolgus TNFRSF17-Fc, the ED50 of biotinylated Cynomolgus TNFRSF17-Fc is 38ng/ml.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-hFc
-
Accession
F7H548 (A134-L285)
-
Gene ID693917
-
Protein Length
Partial
-
Synonyms
TNFSF13B; Dendritic Cell-Derived TNF-Like Molecule; Prev. TNFSF20; Tumor Necrosis Factor Ligand 7A; TALL-1; ZTNF4; TALL1; Tumor Necrosis Factor (Ligand) Superfamily, Member 20; BAFF; TNF- And APOL-Related Leukocyte Expressed Ligand 1; BLYS; Tumor Necrosis
-
AA Sequence
AIQGAEETVIQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
-
Predicted Molecular Mass
45.5 kDa
-
Molecular Weight
Approximately 47 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, PH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
