Bax Protein, Human (Cell-Free, His)
Based on 1 Customer Validation
Bax Protein, Human (Cell-Free, His) is the recombinant human-derived Bax, expressed by E. coli Cell-free, with N-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Bax Protein, Human (Cell-Free, His) is the recombinant human-derived Bax, expressed by E. coli Cell-free, with N-10*His labeled tag.
Background
Bax is a protein that plays a key role in the mitochondrial apoptotic process. Under normal conditions, Bax is largely cytosolic due to constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, preventing toxic accumulation at the mitochondrial outer membrane (MOM). Under stress conditions, Bax undergoes a conformational change and translocates to the mitochondrial membrane, triggering cytochrome c release and subsequent apoptosis. Additionally, Bax promotes the activation of CASP3, thereby inducing apoptosis. by similar: These functions have been consistently demonstrated across multiple studies.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q07812-1 (M1-G192)
-
Gene ID581
-
Protein Length
Full Length of Isoform-1
-
Synonyms
BAX; BCL2-Associated X Protein Omega; BCL2 Associated X, Apoptosis Regulator; BCL2-Associated X Protein Theta; BCL2L4; Baxdelta2(G8)-RFS Protein; Apoptosis Regulator BAX; Baxdelta2G9omega; BCL2-Associated X Protein; Baxdelta2omega; BCL2 Associated X Protein; Baxdelta2G9; Bcl-2-Like Protein 4; Bax Protein; Bcl2-L-4
-
AA Sequence
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
-
Predicted Molecular Mass
23.3 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij78, 6% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
