1. Recombinant Proteins
  2. Others
  3. Bax Protein, Human (Cell-Free, His)

Bax Protein, Human (Cell-Free, His) is the recombinant human-derived Bax, expressed by E. coli Cell-free, with N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Bax Protein, Human (Cell-Free, His) is the recombinant human-derived Bax, expressed by E. coli Cell-free, with N-10*His labeled tag.

Background

Bax is a protein that plays a key role in the mitochondrial apoptotic process. Under normal conditions, Bax is largely cytosolic due to constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, preventing toxic accumulation at the mitochondrial outer membrane (MOM). Under stress conditions, Bax undergoes a conformational change and translocates to the mitochondrial membrane, triggering cytochrome c release and subsequent apoptosis. Additionally, Bax promotes the activation of CASP3, thereby inducing apoptosis. by similar: These functions have been consistently demonstrated across multiple studies.

Species

Human

Source

E. coli Cell-free

Tag

N-10*His

Accession

Q07812-1 (M1-G192)

Gene ID

581

Protein Length

Full Length of Isoform-1

Synonyms
rHuBCL2L4, His; Apoptosis Regulator BAX; Bcl-2-Like Protein 4; BCL2L4; BAX
AA Sequence

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Molecular Weight

23.3 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Bax Protein, Human (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Bax Protein, Human (Cell-Free, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Bax Protein, Human (Cell-Free, His)
Cat. No.:
HY-P702614
Quantity:
MCE Japan Authorized Agent: