Beta-mannanase Protein, Lonsdalea quercina
Beta-mannanase is a member of the glycosyl hydrolase 26 family. Beta-mannanase Protein, Lonsdalea quercina is the recombinant Beta-mannanase protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Beta-mannanase is a member of the glycosyl hydrolase 26 family. Beta-mannanase Protein, Lonsdalea quercina is the recombinant Beta-mannanase protein, expressed by E. coli , with tag free.
Background
β-Mannanase is an enzyme that breaks down β-mannan and is a member of the glycosyl hydrolase 26 family. β-Mannan is a complex carbohydrate found in plant cell walls that is widely used in industries such as animal feed, food, and textiles for its benefits in improving digestion, enhancing product processing, and removing stains.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
PPL06740.1 (M1-S348)
-
Gene ID/
-
Molecular Construction
-
N-term
-
Beta-mannanase (M1-S348)
Accession # PPL06740.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SAMN02982996_03194; beta-mannanase; Mannan endo-1,4-beta-mannosidase
-
AA Sequence
MSTFTVVPANQSADNNAKMIYQWLSGLSERQGKKLISGIFGGYSNIGGVDAFSLQQGKELQALTGKFPAIYSADYARGWDACTPGEEASLIDFGCNADLIDHWKKGGLVAISHHLPNPCFAGNNPGDGKGALKHPVSNDEFSAILQSGTPSRGRWLAMLDKVAQGLQQLNEKGVTVFYRPLHEMNGEWFWWGATGENTNDTVRMDLYRRLYQDIFNYFVKTKGLNNLLWVFSPDANRDYKTSYYPGAEYVDITGLDLYTDNPATVNGYDEMVALNKPFAFAEVGPSTINGQFDYANLVSVILQKYPKATMFIPWNNDWSPLKNLNASGAYNNDRVINLGDVWNGSVLS
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
