1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Betacellulin
  5. Betacellulin/BTC Protein, Mouse (HEK293, His-hFc)

Betacellulin/BTC Protein, Mouse (HEK293, His-hFc)

Cat. No.: HY-P75478
Handling Instructions Technical Support

Betacellulin/BTC Protein, a growth factor with affinity for EGFR, ERBB4, and other EGF receptor family members, exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells as a monomer. Its molecular activity involves interactions with EGFR and ERBB4, contributing to cellular signaling and regulation. Betacellulin/BTC Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived Betacellulin/BTC protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Betacellulin/BTC Protein, a growth factor with affinity for EGFR, ERBB4, and other EGF receptor family members, exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells as a monomer. Its molecular activity involves interactions with EGFR and ERBB4, contributing to cellular signaling and regulation. Betacellulin/BTC Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived Betacellulin/BTC protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

Betacellulin/BTC Protein is a growth factor exhibiting affinity for EGFR, ERBB4, and other members of the EGF receptor family. It exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells, functioning as a monomer. Its molecular activity involves interactions with both EGFR and ERBB4, contributing to its role in cellular signaling and regulation.

Species

Mouse

Source

HEK293

Tag

C-hFc;C-His

Accession

Q05928 (D32-Q118)

Gene ID

12223  [NCBI]

Molecular Construction
N-term
BTC (D32-Q118)
Accession # Q05928
hFc-His
C-term
Protein Length

Extracellular Domain

Synonyms
Btc; Betacellulin; Betacellulin epidermal growth factor family member
AA Sequence

DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFYLQQDRGQ

Predicted Molecular Mass
38 kDa
Molecular Weight

Approximately 50-55 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Betacellulin/BTC Protein, Mouse (HEK293, His-hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Betacellulin/BTC Protein, Mouse (HEK293, His-hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Betacellulin/BTC Protein, Mouse (HEK293, His-hFc)
Cat. No.:
HY-P75478
Quantity:
MCE Japan Authorized Agent: