Betacellulin/BTC Protein, Mouse (HEK293, His-hFc)
Betacellulin/BTC Protein, a growth factor with affinity for EGFR, ERBB4, and other EGF receptor family members, exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells as a monomer. Its molecular activity involves interactions with EGFR and ERBB4, contributing to cellular signaling and regulation. Betacellulin/BTC Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived Betacellulin/BTC protein, expressed by HEK293 , with C-hFc, C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Betacellulin/BTC Protein, a growth factor with affinity for EGFR, ERBB4, and other EGF receptor family members, exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells as a monomer. Its molecular activity involves interactions with EGFR and ERBB4, contributing to cellular signaling and regulation. Betacellulin/BTC Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived Betacellulin/BTC protein, expressed by HEK293 , with C-hFc, C-His labeled tag.
Background
Betacellulin/BTC Protein is a growth factor exhibiting affinity for EGFR, ERBB4, and other members of the EGF receptor family. It exerts potent mitogenic effects on retinal pigment epithelial cells and vascular smooth muscle cells, functioning as a monomer. Its molecular activity involves interactions with both EGFR and ERBB4, contributing to its role in cellular signaling and regulation.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc;C-His
-
Accession
Q05928 (D32-Q118)
-
Gene ID12223 [NCBI]
-
Molecular Construction
-
N-term
-
BTC (D32-Q118)
Accession # Q05928 -
hFc-His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
BTC; Probetacellulin; Betacellulin; Betacellulin Isoform 2
-
AA Sequence
DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFYLQQDRGQ
-
Predicted Molecular Mass
38 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions,due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
