BIKE Protein, Human (His, Strep)
BIKE Protein, Human (His, Strep) is the recombinant human-derived BIKE, expressed by E. coli, with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
BIKE Protein, Human (His, Strep) is the recombinant human-derived BIKE, expressed by E. coli, with Strep, His labeled tag.
Background
BIKE may be involved in osteoblast differentiation. by similar: The function of this gene may be related to osteoblast differentiation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q9NSY1-1 (S38-E345)
-
Gene ID55589
-
Protein Length
Partial
-
Synonyms
BMP2K; DKFZp434K0614; BMP2 Inducible Kinase; Non-Specific Serine/Threonine Protein Kinase; BIKe; HRIHFB2017; BMP-2-Inducible Protein Kinase; BIKE
-
AA Sequence
SVGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASE
-
Predicted Molecular Mass
37.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)