BIKE Protein, Human (His, Strep)

BIKE Protein, Human (His, Strep) is the recombinant human-derived BIKE, expressed by E. coli, with Strep, His labeled tag.

BIKE may be involved in osteoblast differentiation. by similar: The function of this gene may be related to osteoblast differentiation.

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

Strep;His

Q9NSY1-1 (S38-E345)

55589

Partial

SVGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASE

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50m M Tris-HCl (pH7.5), 200 mM NaCl, 20% glycerol, 1 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.