BLOT2 Protein, Blomia tropicalis (HEK293, His)
BLOT1 Protein is a Blomia tropicalis allergen and is highly homologous to cysteine proteases. BLOT1 may play a major role as an immunodominant allergen involved in dust mite-specific IgE-mediated hypersensitivity. BLOT1, like the other group 1 HDM allergens, is a digestive enzyme associated with mite fecal pellets. BLOT2 Protein, Blomia tropicalis (HEK293, His) is the recombinant BLOT2 protein, expressed by HEK293 , with N-6*His labeled tag.
- Species: Others
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BLOT1 Protein is a Blomia tropicalis allergen and is highly homologous to cysteine proteases. BLOT1 may play a major role as an immunodominant allergen involved in dust mite-specific IgE-mediated hypersensitivity. BLOT1, like the other group 1 HDM allergens, is a digestive enzyme associated with mite fecal pellets. BLOT2 Protein, Blomia tropicalis (HEK293, His) is the recombinant BLOT2 protein, expressed by HEK293 , with N-6*His labeled tag.
Background
BLOT1 is a Blomia tropicalis allergen and is highly homologous to cysteine proteases. BLOT1 may play a major role as an immunodominant allergen involved in dust mite-specific IgE-mediated hypersensitivity. BLOT1, like the other group 1 HDM allergens, is a digestive enzyme associated with mite fecal pellets[1][2].
Technical Parameters
-
Species Others
-
Source HEK293
-
Tag N-6*His
-
Accession
AAQ73483 (M1-D144)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
BLOT2 (M1-D144)
Accession # AAQ73483 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Type 2 allergen Blo t 2.047
-
AA Sequence
MFKFICLALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEVVD
-
Predicted Molecular Mass
15 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
