1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. Bone Morphogenetic Protein 5
  6. BMP-5 Protein, Human (HEK293, hFc)

Bone morphogenetic protein 5 (BMP-5) is a pleiotropic ligand protein belonging to the TGFβ family, which is mainly expressed in the lung and liver. After BMP-5 silencing, the activity of p38/ERK signaling pathway can be down-regulated to inhibit chondrocyte senescence and apoptosis and knee arthritis (OA). Bmp-5 initiates typical BMP signaling cascades by binding to type I receptor BMPR1A and type II receptor BMPR2, or triggers signals through atypical pathways such as MAPK p38 signaling cascades to promote chondrogenic differentiation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Bone morphogenetic protein 5 (BMP-5) is a pleiotropic ligand protein belonging to the TGFβ family, which is mainly expressed in the lung and liver. After BMP-5 silencing, the activity of p38/ERK signaling pathway can be down-regulated to inhibit chondrocyte senescence and apoptosis and knee arthritis (OA)[1]. Bmp-5 initiates typical BMP signaling cascades by binding to type I receptor BMPR1A and type II receptor BMPR2[2], or triggers signals through atypical pathways such as MAPK p38 signaling cascades to promote chondrogenic differentiation[3].

Background

Bone Morphogenetic Protein 5 (BMP-5) is a ligand protein with pleiotropic, belongs to TGFβ family and expresses mainly in the lung and liver. BMP/TGFβ signaling to involve in vascular and valvular homeostasis, which is a critical process of embryonic development[4]. And BMP/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[5].
BMP-5 silencing inhibits chondrocyte senescence and apoptosis as well as osteoarthritis (OA) progression by downregulating activity in the p38/ERK signaling pathway[1].
BMP-5 initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2[2].
BMP-5 also triggers signal through non-canonical pathway such as MAPK p38 signaling cascade to promote chondrogenic differentiation[3].
BMP-5 specific expressing in neural crest progenitor cells is sufficient to induce cell proliferation through the MEK-ERK-ID3 signaling cascade, whereas disruption of this signaling cascade had no effect on cell survival[6].

In Vitro

BMP-5 (3 ng/mL; 1, 3, 5, 7, and 17 d) induces SCG neurons dendritic growth[2].
BMP-5 (1 ng/mL; , 3, and 6 min) induces phosphorylation of Smad-1 in cultured sympathetic neurons[2].
BMP-5 (.1-1 ng/mL; 6 d) is less potent than BMP-7 in dendritic growth in cultured sympathetic neurons, but equally efficacious in promoting dendritic growth in cultured sympathetic neurons[2].

Biological Activity

Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.7568 µg/mL, corresponding to a specific activity is 1.32×103 U/mg.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

NP_066551.1 (Q324-H454)

Gene ID

653  [NCBI]

Molecular Construction
N-term
hFc
BMP-5 (Q324-H454)
Accession # NP_066551.1
C-term
Protein Length

Partial

Synonyms
Bone morphogenetic protein 5; BMP-5
AA Sequence

QNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH

Predicted Molecular Mass
41.5 kDa
Molecular Weight

Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Structure/Form
disulfide-linked homodimer
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BMP-5 Protein, Human (HEK293, hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-5 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P75472
Quantity:
MCE Japan Authorized Agent: