BMP-5 Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
Bone morphogenetic protein 5 (BMP-5) is a pleiotropic ligand protein belonging to the TGFβ family, which is mainly expressed in the lung and liver. After BMP-5 silencing, the activity of p38/ERK signaling pathway can be down-regulated to inhibit chondrocyte senescence and apoptosis and knee arthritis (OA). Bmp-5 initiates typical BMP signaling cascades by binding to type I receptor BMPR1A and type II receptor BMPR2, or triggers signals through atypical pathways such as MAPK p38 signaling cascades to promote chondrogenic differentiation.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Bone morphogenetic protein 5 (BMP-5) is a pleiotropic ligand protein belonging to the TGFβ family, which is mainly expressed in the lung and liver. After BMP-5 silencing, the activity of p38/ERK signaling pathway can be down-regulated to inhibit chondrocyte senescence and apoptosis and knee arthritis (OA)[1]. Bmp-5 initiates typical BMP signaling cascades by binding to type I receptor BMPR1A and type II receptor BMPR2[2], or triggers signals through atypical pathways such as MAPK p38 signaling cascades to promote chondrogenic differentiation[3].
Bone Morphogenetic Protein 5 (BMP-5) is a ligand protein with pleiotropic, belongs to TGFβ family and expresses mainly in the lung and liver. BMP/TGFβ signaling to involve in vascular and valvular homeostasis, which is a critical process of embryonic development[4]. And BMP/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[5].
BMP-5 silencing inhibits chondrocyte senescence and apoptosis as well as osteoarthritis (OA) progression by downregulating activity in the p38/ERK signaling pathway[1].
BMP-5 initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2[2].
BMP-5 also triggers signal through non-canonical pathway such as MAPK p38 signaling cascade to promote chondrogenic differentiation[3].
BMP-5 specific expressing in neural crest progenitor cells is sufficient to induce cell proliferation through the MEK-ERK-ID3 signaling cascade, whereas disruption of this signaling cascade had no effect on cell survival[6].
BMP-5 (3 ng/mL; 1, 3, 5, 7, and 17 d) induces SCG neurons dendritic growth[2].
BMP-5 (1 ng/mL; , 3, and 6 min) induces phosphorylation of Smad-1 in cultured sympathetic neurons[2].
BMP-5 (.1-1 ng/mL; 6 d) is less potent than BMP-7 in dendritic growth in cultured sympathetic neurons, but equally efficacious in promoting dendritic growth in cultured sympathetic neurons[2].
Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.7568 µg/mL, corresponding to a specific activity is 1.32×103 U/mg.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
NP_066551.1 (Q324-H454)
-
Molecular Construction
-
N-term
-
hFc
-
BMP-5 (Q324-H454)
Accession # NP_066551.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
BMP5; Bone Morphogenenic Protein-5; Bone Morphogenetic Protein 5; BMP-5
-
AA Sequence
QNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
-
Predicted Molecular Mass
41.5 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
disulfide-linked homodimer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Shao Y, et al. BMP5 silencing inhibits chondrocyte senescence and apoptosis as well as osteoarthritis progression in mice. Aging (Albany NY). 2021 Mar 19;13(7):9646-9664. [Content Brief]
[2]. Beck HN, et al. Bone morphogenetic protein-5 (BMP-5) promotes dendritic growth in cultured sympathetic neurons. BMC Neurosci. 2001;2:12. [Content Brief]
[3]. Snelling SJ, et al. BMP5 activates multiple signaling pathways and promotes chondrogenic differentiation in the ATDC5 growth plate model. Growth Factors. 2010 Aug;28(4):268-79. [Content Brief]
[4]. Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542. [Content Brief]
[5]. Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9(3):a022095. [Content Brief]
[6]. Shih HY, et al. Bmp5 Regulates Neural Crest Cell Survival and Proliferation via Two Different Signaling Pathways. Stem Cells. 2017 Apr;35(4):1003-1014. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
