BRAP Protein, Human
BRAP protein acts as a negative regulator of MAP kinase activation, inhibits the formation of the Raf/MEK complex, and may inactivate the KSR1 scaffolding protein. As a Ras-responsive E3 ubiquitin ligase, BRAP undergoes autopolyubiquitination upon Ras activation, releasing its inhibitory effect on Raf/MEK complex formation. BRAP Protein, Human is the recombinant human-derived BRAP protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BRAP protein acts as a negative regulator of MAP kinase activation, inhibits the formation of the Raf/MEK complex, and may inactivate the KSR1 scaffolding protein. As a Ras-responsive E3 ubiquitin ligase, BRAP undergoes autopolyubiquitination upon Ras activation, releasing its inhibitory effect on Raf/MEK complex formation. BRAP Protein, Human is the recombinant human-derived BRAP protein, expressed by E. coli , with tag free.
Background
BRAP protein functions as a negative regulator of MAP kinase activation, primarily by restricting the formation of Raf/MEK complexes, potentially through the inactivation of the KSR1 scaffold protein. Additionally, it operates as a Ras-responsive E3 ubiquitin ligase, which, upon Ras activation, undergoes auto-polyubiquitination, leading to the release of its inhibitory effect on Raf/MEK complex formation. Beyond its role in kinase signaling, BRAP may serve as a cytoplasmic retention protein, playing a part in the regulation of nuclear transport processes. This multifaceted functionality positions BRAP as a crucial player in modulating key cellular pathways and responses.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q7Z569 (S2-K592)
-
Gene ID8315
-
Molecular Construction
-
N-term
-
BRAP (S2-K592)
Accession # Q7Z569 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
BRAP; RING-Type E3 Ubiquitin Transferase BRAP2; BRCA1 Associated Protein; BRCA1-Associated Protein; BRAP2; Renal Carcinoma Antigen NY-REN-63; Impedes Mitogenic Signal Propagation; Galectin-2-Binding Protein; RNF52; RING Finger Protein 52; IMP
-
AA Sequence
SVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSKQLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKFVAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVERAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTCPVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQRIYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKVAKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKRGK
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
