¹³C, ¹⁵N-Labeled IGF-I/IGF-1 Protein, Human (70a.a)
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P05019-1 (G49-A118)
-
Gene ID3479
-
Molecular Construction
-
N-term
-
IGF-1 (G49-A118)
Accession # P05019-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
¹⁵N,¹³C-Somatomedin C; ¹⁵N,¹³C-Mechano growth factor; IGF1; Somatomedin-C; Insulin Like Growth Factor 1; IGF1A; IGF-I; MGF; Insulin-Like Growth Factor 1; Insulin-Like Growth Factor IB; Insulin-Like Growth Factor I; Insulin-Like Growth Factor-I; IGFI; Alternative Protein IGF1; IGF; Somatomedin C; Insulin-Like Growth Factor 1 (Somatomedin C); IGF-1; Mechano Growth Factor; IBP1
-
AA Sequence
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)