CD93/C1qR1 Protein, Human (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

The CD93/C1qR1 protein is thought to be a receptor or part of a larger complex and plays a crucial role in immune recognition by binding to C1q, mannose-binding lectin (MBL2), and pulmonary surfactant protein A (SPA) . Its interaction with these immune factors suggests a role in coordinating the innate immune response. CD93/C1qR1 Protein, Human (HEK293, His, solution) is the recombinant human-derived C1qR1/CD93 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD93/C1qR1 protein is thought to be a receptor or part of a larger complex and plays a crucial role in immune recognition by binding to C1q, mannose-binding lectin (MBL2), and pulmonary surfactant protein A (SPA) . Its interaction with these immune factors suggests a role in coordinating the innate immune response. CD93/C1qR1 Protein, Human (HEK293, His, solution) is the recombinant human-derived C1qR1/CD93 protein, expressed by HEK293, with C-His labeled tag.

Background

CD93/C1qR1 Protein, identified as a receptor or a component of a larger receptor complex, plays a crucial role in immune recognition by serving as a binding site for C1q, mannose-binding lectin (MBL2), and pulmonary surfactant protein A (SPA). Its interaction with these immune factors suggests a role in orchestrating innate immune responses. CD93/C1qR1 may also participate in the modulation of phagocytosis in monocytes and macrophages, particularly when interacting with soluble defense collagens. Additionally, it appears to be involved in intercellular adhesion, indicating a potential role in cellular interactions beyond immune recognition. The observed interaction with C1QBP further implies its association with cell surface C1q, highlighting the intricate involvement of CD93/C1qR1 in immune-related processes and suggesting its significance in cellular responses to external challenges.

Verified Bioactivity

Immobilized Human CD93 (His Tag) at 2 μg/ml (100 μl/well) can bind Human IGFBP7 (hFc Tag). The EC50 is 6.3-60 ng/ml.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD93; DJ737E23.1; Prev. C1QR1; ECSM3; Prev. MXRA4; Matrix-Remodeling-Associated Protein 4; C1qR(P); Matrix-Remodelling Associated 4; CDw93; C1qR; Complement Component 1 Q Subcomponent Receptor 1; Complement Component 1, Q Subcomponent, Receptor 1; Complem

  • AA Sequence

    TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK

  • Predicted Molecular Mass

    59.6 kDa

  • Molecular Weight

    Approximately 100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00