CA125 Protein, Human (685a.a, HEK293, His)
Based on 1 Customer Validation
The CA125 protein acts by binding to MSLN and plays a crucial role in forming a protective and lubricating barrier on mucosal surfaces. This interaction promotes heterotypic cell adhesion and is suggested to play an important role in peritoneal metastasis of ovarian cancer. CA125 Protein, Human (685a.a, HEK293, His) is the recombinant human-derived CA125 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CA125 protein acts by binding to MSLN and plays a crucial role in forming a protective and lubricating barrier on mucosal surfaces. This interaction promotes heterotypic cell adhesion and is suggested to play an important role in peritoneal metastasis of ovarian cancer. CA125 Protein, Human (685a.a, HEK293, His) is the recombinant human-derived CA125 protein, expressed by HEK293 , with C-His labeled tag.
Background
CA125 protein is believed to serve a crucial role in establishing a protective and lubricating barrier against particles and infectious agents at mucosal surfaces. It exerts its functions through binding to MSLN, where the interaction mediates heterotypic cell adhesion. This adhesive property may play a significant role in the metastasis of ovarian cancer to the peritoneum, as CA125 initiates cell attachment to the mesothelial epithelium by binding to MSLN. The interaction between CA125 and MSLN underscores its potential involvement in the adhesive events associated with cancer metastasis, particularly in the context of ovarian cancer progression to the peritoneal cavity.
Verified Bioactivity
Immobilized Human CA125, His Tag at 1μg/ml (100μl/well) on the plate. Dose response curve for Human MSLN, hFc Tag with the EC50 of 3.7ng/ml determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His
-
Accession
Q8WXI7 (D12783-S13467)
-
Molecular Construction
-
N-term
-
CA125 (D12783-S13467)
Accession # Q8WXI7 -
8*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
MUC16; FLJ14303; Mucin 16, Cell Surface Associated; Mucin-16; CA125; CA125 Ovarian Cancer Antigen; CA-125; Mucin-16 Short Isoform; Ovarian Cancer-Related Tumor Marker CA125; Mucin-16 Long Isoform; Ovarian Carcinoma Antigen CA125; MUC-16; Cancer Antigen 12
-
AA Sequence
DREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGMDAICSHRLDPKSPGLNREQLYWELSQLTHGIKELGPYTLDRNSLYVNGFTHRSSVAPTSTPGTSTVDLGTSGTPSSLPSPTTAVPLLVPFTLNFTITNLQYGEDMRHPGSRKFNTTERVLQGLLGPLFKNSSVGPLYSGCRLISLRSEKDGAATGVDAICTHHLNPQSPGLDREQLYWQLSQMTNGIKELGPYTLDRNSLYVNGFTHRSSGLTTSTPWTSTVDLGTSGTPSPVPSPTTTGPLLVPFTLNFTITNLQYEENMGHPGSRKFNITESVLQGLLKPLFKSTSVGPLYSGCRLTLLRPEKDGVATRVDAICTHRPDPKIPGLDRQQLYWELSQLTHSITELGPYTLDRDSLYVNGFTQRSSVPTTSTPGTFTVQPETSETPSSLPGPTATGPVLLPFTLNFTITNLQYEEDMRRPGSRKFNTTERVLQGLLMPLFKNTSVSSLYSGCRLTLLRPEKDGAATRVDAVCTHRPDPKSPGLDRERLYWKLSQLTHGITELGPYTLDRHSLYVNGFTHQSSMTTTRTPDTSTMHLATSRTPAS
-
Predicted Molecular Mass
76.2 kDa
-
Molecular Weight
Approximately 90-140 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (240 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)