Cadherin-17 Protein, Human (106a.a, HEK293, mFc)
Cadherin-17 protein mediates cell-cell interactions, sorting and organizing heterogeneous cell types by preferentially binding to other Cadherin-17 molecules. LI-cadherin, a subtype of Cadherin-17, is implicated in liver and intestinal morphological organization. Cadherin-17 also facilitates intestinal peptide transport, emphasizing its functional significance. Cadherin-17 Protein, Human (106a.a, HEK293, mFc) is the recombinant human-derived Cadherin-17 protein, expressed by HEK293, with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Cadherin-17 protein mediates cell-cell interactions, sorting and organizing heterogeneous cell types by preferentially binding to other Cadherin-17 molecules. LI-cadherin, a subtype of Cadherin-17, is implicated in liver and intestinal morphological organization. Cadherin-17 also facilitates intestinal peptide transport, emphasizing its functional significance. Cadherin-17 Protein, Human (106a.a, HEK293, mFc) is the recombinant human-derived Cadherin-17 protein, expressed by HEK293, with C-mFc labeled tag.
Background
Cadherin-17 protein, a calcium-dependent cell adhesion molecule, is involved in mediating cell-cell interactions. Through its preferential homophilic interaction with other cadherin molecules of the same type in connecting cells, Cadherin-17 contributes to the sorting and organization of heterogeneous cell types. Specifically, LI-cadherin, a subtype of Cadherin-17, may play a role in the morphological organization of the liver and intestine. Furthermore, Cadherin-17 is involved in facilitating intestinal peptide transport, highlighting its functional significance in cellular processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q12864 (Q23-Q128)
-
Gene ID1015
-
Molecular Construction
-
N-term
-
Cadherin-17 (Q23-Q128)
Accession # Q12864 -
mFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CDH17; Human Intestinal Peptide-Associated Transporter HPT-1; Cadherin 17; Human Peptide Transporter 1; Liver-Intestine Cadherin; HPT-1 Cadherin; Cadherin-17; LI Cadherin; HPT-1; Cadherin-16; Intestinal Peptide-Associated Transporter HPT-1; LI-Cadherin; C
-
AA Sequence
QEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDINDNRPTFLQ
-
Predicted Molecular Mass
38.3 kDa
-
Molecular Weight
Approximately 43-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)