Cadherin-17 Protein, Human (106a.a, HEK293, mFc)

Cadherin-17 protein mediates cell-cell interactions, sorting and organizing heterogeneous cell types by preferentially binding to other Cadherin-17 molecules. LI-cadherin, a subtype of Cadherin-17, is implicated in liver and intestinal morphological organization. Cadherin-17 also facilitates intestinal peptide transport, emphasizing its functional significance. Cadherin-17 Protein, Human (106a.a, HEK293, mFc) is the recombinant human-derived Cadherin-17 protein, expressed by HEK293, with C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Cadherin-17 protein mediates cell-cell interactions, sorting and organizing heterogeneous cell types by preferentially binding to other Cadherin-17 molecules. LI-cadherin, a subtype of Cadherin-17, is implicated in liver and intestinal morphological organization. Cadherin-17 also facilitates intestinal peptide transport, emphasizing its functional significance. Cadherin-17 Protein, Human (106a.a, HEK293, mFc) is the recombinant human-derived Cadherin-17 protein, expressed by HEK293, with C-mFc labeled tag.

Background

Cadherin-17 protein, a calcium-dependent cell adhesion molecule, is involved in mediating cell-cell interactions. Through its preferential homophilic interaction with other cadherin molecules of the same type in connecting cells, Cadherin-17 contributes to the sorting and organization of heterogeneous cell types. Specifically, LI-cadherin, a subtype of Cadherin-17, may play a role in the morphological organization of the liver and intestine. Furthermore, Cadherin-17 is involved in facilitating intestinal peptide transport, highlighting its functional significance in cellular processes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-mFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Cadherin-17 (Q23-Q128)
      Accession # Q12864
    • mFc
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    CDH17; Human Intestinal Peptide-Associated Transporter HPT-1; Cadherin 17; Human Peptide Transporter 1; Liver-Intestine Cadherin; HPT-1 Cadherin; Cadherin-17; LI Cadherin; HPT-1; Cadherin-16; Intestinal Peptide-Associated Transporter HPT-1; LI-Cadherin; C

  • AA Sequence

    QEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDINDNRPTFLQ

  • Predicted Molecular Mass

    38.3 kDa

  • Molecular Weight

    Approximately 43-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00