1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Cell Adhesion Molecule 3 (CADM3)
  6. CADM3 Protein, Cynomolgus (HEK293, His)

Nectin-4 protein is an important member of the Nectin family and contributes significantly to cell adhesion and signaling processes. As part of this family, Nectin-4 plays a critical role in mediating cell-cell interactions, affecting various physiological and developmental functions. CADM3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Nectin-4 protein is an important member of the Nectin family and contributes significantly to cell adhesion and signaling processes. As part of this family, Nectin-4 plays a critical role in mediating cell-cell interactions, affecting various physiological and developmental functions. CADM3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.

Background

The CADM3 Protein is an integral member of the nectin family, playing a crucial role in cell adhesion and signaling processes. As part of this family, CADM3 contributes significantly to mediating cell-cell interactions, influencing various physiological and developmental functions. Its involvement in cell adhesion implies implications for tissue organization and maintenance. Moreover, CADM3 has garnered attention for its potential role in cancer, particularly in modulating tumor cell invasion and metastasis. By belonging to the nectin family, the CADM3 Protein underscores its importance in fundamental cellular processes and highlights its potential significance as a therapeutic target in diverse pathological conditions.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5UJL5 (N23-T326)

Gene ID

102129491

Molecular Construction
N-term
CADM3 (N23-T326)
Accession # A0A2K5UJL5
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
IgSF4B; NECL-1; SynCAM3; GSF4B; NECL1; TSLL1; CADM3; BIgR; IGSF4B; member 4B; TSLC1-like 1
AA Sequence

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGANIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSST

Predicted Molecular Mass
34.5 kDa
Molecular Weight

Approximately 40-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CADM3 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CADM3 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700962
Quantity:
MCE Japan Authorized Agent: