CADM3 Protein, Cynomolgus (HEK293, His)
Nectin-4 protein is an important member of the Nectin family and contributes significantly to cell adhesion and signaling processes. As part of this family, Nectin-4 plays a critical role in mediating cell-cell interactions, affecting various physiological and developmental functions. CADM3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Nectin-4 protein is an important member of the Nectin family and contributes significantly to cell adhesion and signaling processes. As part of this family, Nectin-4 plays a critical role in mediating cell-cell interactions, affecting various physiological and developmental functions. CADM3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CADM3 protein, expressed by HEK293 , with C-His labeled tag.
Background
The CADM3 Protein is an integral member of the nectin family, playing a crucial role in cell adhesion and signaling processes. As part of this family, CADM3 contributes significantly to mediating cell-cell interactions, influencing various physiological and developmental functions. Its involvement in cell adhesion implies implications for tissue organization and maintenance. Moreover, CADM3 has garnered attention for its potential role in cancer, particularly in modulating tumor cell invasion and metastasis. By belonging to the nectin family, the CADM3 Protein underscores its importance in fundamental cellular processes and highlights its potential significance as a therapeutic target in diverse pathological conditions.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5UJL5 (N23-T326)
-
Gene ID102129491
-
Molecular Construction
-
N-term
-
CADM3 (N23-T326)
Accession # A0A2K5UJL5 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CADM3; FLJ10698; Prev. IGSF4B; Nectin-Like Protein 1; SynCAM3; TSLC1-Like Protein 1; TSLL1; Nectin-Like 1; NECL1; TSLC1-Like 1; Necl-1; SYNCAM3; BIgR; CMT2FF; Immunoglobulin Superfamily Member 4B; NECL-1; Synaptic Cell Adhesion Molecule 3; IgSF4B; Brain I
-
AA Sequence
NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGANIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSST
-
Predicted Molecular Mass
34.5 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
