Copy Link Print Information

Carbonic Anhydrase 10 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Carbonic Anhydrase 10 Protein, a member of the carbonic anhydrase family, plays a role in the regulation of pH and ion transport. It is expressed in various tissues, including the brain, liver, and kidney. The potential involvement of Carbonic Anhydrase 10 Protein in diseases and its physiological functions make it a subject of interest in biomedical research. Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Carbonic Anhydrase 10 Protein, Mouse (HEK293, His)
  • Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Carbonic Anhydrase 10 Protein, a member of the carbonic anhydrase family, plays a role in the regulation of pH and ion transport. It is expressed in various tissues, including the brain, liver, and kidney. The potential involvement of Carbonic Anhydrase 10 Protein in diseases and its physiological functions make it a subject of interest in biomedical research. Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with C-His labeled tag.

Background

Carbonic Anhydrase 10 (CA10) is a member of the alpha-carbonic anhydrase family and is characterized by the absence of catalytic activity. While it shares structural features with other carbonic anhydrases, CA10 diverges functionally by not participating in the catalysis of carbon dioxide and water to form bicarbonate and protons. The distinct properties of CA10 within the alpha-carbonic anhydrase family highlight its unique role, likely involving functions other than the canonical enzymatic activity associated with this protein family.

Verified Bioactivity

Measured by its esterase activity. The specific activity is 130.5 pmol/min/μg, as measured with 1 mM 4-Nitrophenyl acetate and 1 μg enzyme at 400 nm in 100 μL of 12.5 mM Tris, 75 mM NaCl, pH 7.5.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    P61215 (M1-N300)

  • Gene ID
    72605  [NCBI]
  • Molecular Construction
    • N-term
    • Ca10 (M1-N300)
      Accession # P61215
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CA10; Carbonic Anhydrase-Related Protein X; Carbonic Anhydrase 10 (Inactive); Carbonic Anhydrase X; Carbonic Anhydrase-Related Protein 10; CA-RP X; Carbonic Anhydrase 10; CARP X; HUCEP-15; Epididymis Secretory Sperm Binding Protein; CA-RPX; Cerebral Prote

  • AA Sequence

    MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 25 mM Tris, 150 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Carbonic Anhydrase 10 Protein, Mouse (HEK293, His)
  • Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) Product Image