1. Recombinant Proteins
  2. Others
  3. CARD11 Protein, Human (His, Strep)

CARD11 Protein, Human (His, Strep) is the recombinant human-derived CARD11, expressed by E. coli , with Strep, His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CARD11 Protein, Human (His, Strep) is the recombinant human-derived CARD11, expressed by E. coli , with Strep, His labeled tag.

Background

CARD11 is an adapter protein that plays a key role in adaptive immune response by transducing the activation of NF-kappa-B downstream of T-cell receptor (TCR) and B-cell receptor (BCR) engagement (by similar). It transduces signals downstream of TCR or BCR activation via the formation of a multiprotein complex with BCL10 and MALT1, inducing NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13, and/or MAPK14) pathways (by similar). Upon TCR or BCR triggering, CARD11 homooligomerizes to form a helical template recruiting BCL10 via CARD-CARD interaction, promoting BCL10 polymerization and subsequent MALT1 recruitment, leading to I-kappa-B kinase (IKK) phosphorylation, degradation, and NF-kappa-B nuclear translocation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a TCR/CD3-dependent manner (by similar). CARD11 promotes linear ubiquitination of BCL10 by targeting it to RNF31/HOIP and stimulates BCL10 phosphorylation (by similar). It also activates the TORC1 signaling pathway.

Species

Human

Source

E. coli

Tag

Strep;His

Accession

Q9BXL7 (A21-S116)

Gene ID

84433

Protein Length

Partial

Synonyms
CARMA1
AA Sequence

ALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFS

Predicted Molecular Mass
14.3 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CARD11 Protein, Human (His, Strep) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CARD11 Protein, Human (His, Strep)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CARD11 Protein, Human (His, Strep)
Cat. No.:
HY-P703369
Quantity:
MCE Japan Authorized Agent: