CARD11 Protein, Human (His, Strep)
CARD11 Protein, Human (His, Strep) is the recombinant human-derived CARD11, expressed by E. coli , with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CARD11 Protein, Human (His, Strep) is the recombinant human-derived CARD11, expressed by E. coli , with Strep, His labeled tag.
Background
CARD11 is an adapter protein that plays a key role in adaptive immune response by transducing the activation of NF-kappa-B downstream of T-cell receptor (TCR) and B-cell receptor (BCR) engagement (by similar). It transduces signals downstream of TCR or BCR activation via the formation of a multiprotein complex with BCL10 and MALT1, inducing NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13, and/or MAPK14) pathways (by similar). Upon TCR or BCR triggering, CARD11 homooligomerizes to form a helical template recruiting BCL10 via CARD-CARD interaction, promoting BCL10 polymerization and subsequent MALT1 recruitment, leading to I-kappa-B kinase (IKK) phosphorylation, degradation, and NF-kappa-B nuclear translocation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a TCR/CD3-dependent manner (by similar). CARD11 promotes linear ubiquitination of BCL10 by targeting it to RNF31/HOIP and stimulates BCL10 phosphorylation (by similar). It also activates the TORC1 signaling pathway.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q9BXL7 (A21-S116)
-
Gene ID84433
-
Protein Length
Partial
-
Synonyms
CARD11; Carma 1; Caspase Recruitment Domain Family Member 11; Caspase Recruitment Domain Family, Member 11; CARMA1; Card-Maguk Protein 1; Caspase Recruitment Domain-Containing Protein 11; IMD11A; BIMP3; IMD11; Bcl10-Interacting Maguk Protein 3; BENTA; CAR
-
AA Sequence
ALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFS
-
Predicted Molecular Mass
14.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
