Cathepsin B Protein, Human (L26V, HEK293)

Cathepsin B Protein, a thiol protease, is crucial for intracellular protein degradation, cleaving matrix extracellular phosphoglycoprotein MEPE. It's implicated in solubilizing cross-linked TG/thyroglobulin in the thyroid follicle lumen. Associated with tumor invasion and metastasis, Cathepsin B signifies potential relevance in cancer-related pathways. Cathepsin B Protein, Human (L26V, HEK293) is the recombinant human-derived Cathepsin B protein, expressed by HEK293 , with L26V mutation.

Cathepsin B Protein, a thiol protease, is thought to play a crucial role in intracellular protein degradation and turnover. This enzyme cleaves matrix extracellular phosphoglycoprotein MEPE and is implicated in the solubilization of cross-linked TG/thyroglobulin within the thyroid follicle lumen. Beyond its role in cellular processes, Cathepsin B has been associated with tumor invasion and metastasis, highlighting its potential significance in cancer-related pathways.

Human

HEK293

Tag Free

P07858-1 (R18-I339, L26V)

1508

Full Length of Isoform-1 Mature Protein

RSRPSFHPVSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.