CCL24/Eotaxin-2 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
CCL24/Eotaxin-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CCL24/Eotaxin-2 protein, expressed by HEK293, with N-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CCL24/Eotaxin-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CCL24/Eotaxin-2 protein, expressed by HEK293, with N-His labeled tag.
Verified Bioactivity
1.Immobilized Cynomolgus CCL24, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-CCL24 Antibody, hFc Tag with the EC50 of ≤71.0 ng/mL determined by ELISA.
2.Immobilized Cynomolgus CCL24, His Tag at 2 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-CCL24 Antibody, hFc Tag with the EC50 of ≤20 ng/mL determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-8*His
-
Accession
A0A7N9CBC6/XP_005549400.1 (H19-H119)
-
Molecular Construction
-
N-term
-
8*His
-
CCL24 (H19-H119)
Accession # A0A2K5TKP2/XP_005549400.1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL24; CK-Beta-6; Prev. SCYA24; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 24; Eotaxin-2; Eosinophil Chemotactic Protein 2; MPIF-2; Chemokine (C-C Motif) Ligand 24; MPIF2; Small-Inducible Cytokine A24; Myeloid Progenitor Inhibitory Factor 2; C
-
AA Sequence
HHIIPTGSVVIPSSCCMSFLSKRIPENRVVSYQLSNRSTCLSMGVIFTTKKGQQFCGDPKQAWVQRYMKNLDAKQKKASPRARAVGVKGPVQRYPGNQTTH
-
Predicted Molecular Mass
12.4 kDa
-
Molecular Weight
Approximately 23-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
