CCN5 Protein, Human (His)
Based on 1 Customer Validation
CCN5 Protein, Human (His) is the recombinant human-derived CCN5 protein, expressed by E. coli, with C-10*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CCN5 Protein, Human (His) is the recombinant human-derived CCN5 protein, expressed by E. coli, with C-10*His tag.
CCN5 may play an important role in modulating bone turnover. It promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. Additionally, CCN5 inhibits osteocalcin production. by similar: No similar content to add.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-10*His
-
Accession
O76076 (M1-F250)
-
Gene ID8839
-
Molecular Construction
-
N-term
-
CCN5 (M1-F250)
Accession # O76076 -
10*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CCN5; Connective Tissue Growth Factor-Related Protein 58; Prev. WISP2; WNT1 Inducible Signaling Pathway Protein 2; CTGF-L; CCN Family Member 5; CT58; WNT1-Inducible-Signaling Pathway Protein 2; WISP-2; CTGFL; Cellular Communication Network Factor 5; Conne
-
AA Sequence
MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
-
Predicted Molecular Mass
36.6 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
