CCNB1 Protein, Human
CCNB1 Protein, Human is the recombinant human-derived CCNB1, expressed by E. coli , with tag Free labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CCNB1 Protein, Human is the recombinant human-derived CCNB1, expressed by E. coli , with tag Free labeled tag. ,
Background
CCNB1 is a protein essential for regulating the cell cycle at the G2/M transition, playing a critical role in ensuring proper cell division.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P14635-1 (N165-V433, C167S, C238S, C350S)
-
Gene ID891
-
Protein Length
Partial
-
Synonyms
CCNB1; G2/Mitotic-Specific Cyclin-B1; Prev. CCNB; Cyclin B1; G2/Mitotic-Specific Cyclin B1
-
AA Sequence
NLSSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNSVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFSLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
-
Predicted Molecular Mass
31.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
