CCR5 Protein-VLP, Human (HEK293)
CCR5 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CCR5 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
Background
CCR5 functions as a receptor for several inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, leading to the transduction of signals that elevate intracellular calcium ion levels. This receptor is implicated in the regulation of granulocytic lineage proliferation or differentiation and plays a crucial role in facilitating T-lymphocyte migration to infection sites by acting as a chemotactic receptor. In the context of microbial infection, CCR5 acts as a coreceptor, with CD4 being the primary receptor, for human immunodeficiency virus-1/HIV-1, underscoring its significance in the cellular response to infections.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P51681 (M1-L352)
-
Gene ID1234
-
Molecular Construction
-
N-term
-
CCR5 (M1-L352)
Accession # P51681 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CCR5; Chemokine (C-C Motif) Receptor 5 (Gene/Pseudogene); Prev. CMKBR5; C-C Motif Chemokine Receptor 5 A159A; CC-CKR-5; Chemokine Recptor CCR5 Delta32; C-C Chemokine Receptor Type 5; Mutant Chemokine Receptor CCR5; IDDM22; Mutant Chemokine Receptor 5; CKR
-
AA Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
-
Glycosylation
Yes
-
Purity
Purity analysis by SDS-PAGE is not available for VLP proteins.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
