CD127/IL-7RA Protein, Human (HEK293, mFc)
CD127/IL-7RA Protein, Human (HEK293, mFc) is the recombinant human-derived CD127/IL-7RA protein, expressed by HEK293, with C-mFc tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD127/IL-7RA Protein, Human (HEK293, mFc) is the recombinant human-derived CD127/IL-7RA protein, expressed by HEK293, with C-mFc tag.
Background
CD127 serves as a receptor for interleukin-7 and also functions as a receptor for thymic stromal lymphopoietin (TSLP).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
P16871-1 (E21-D239)
-
Gene ID3575
-
Molecular Construction
-
N-term
-
IL-7RA (E21-D239)
Accession # P16871-1 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL7R; Soluble Interleukin-7 Receptor; Interleukin 7 Receptor; IL-7 Receptor Subunit Alpha; CDw127; IL-7R Subunit Alpha; Interleukin-7 Receptor Subunit Alpha; CD127 Antigen; IL-7Ralpha; IL-7R-Alpha; IL7Ralpha; Interleukin 7 Receptor Alpha Chain; Lnc-IL7R;
-
AA Sequence
ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD
-
Predicted Molecular Mass
51.8 kDa
-
Molecular Weight
Approximately 65-85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
