Copy Link Print Information

CD14 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD14 protein is a key coreceptor that cooperates with LBP to bind LPS and deliver it to the LY96/TLR4 complex to generate an immune response. CD14 activates NF-kappa-B through MyD88, TIRAP and TRAF6, triggering inflammation and cytokine release. CD14 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD14 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CD14 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD14 protein is a key coreceptor that cooperates with LBP to bind LPS and deliver it to the LY96/TLR4 complex to generate an immune response. CD14 activates NF-kappa-B through MyD88, TIRAP and TRAF6, triggering inflammation and cytokine release. CD14 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD14 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD14 Protein serves as a key coreceptor for bacterial lipopolysaccharide (LPS), collaborating with LBP to bind monomeric LPS and deliver it to the LY96/TLR4 complex, thereby orchestrating the innate immune response. Operating through MyD88, TIRAP, and TRAF6, CD14 activates NF-kappa-B, triggering cytokine release and inflammation. It also functions as a coreceptor for TLR2:TLR6 and TLR2:TLR1 heterodimers in response to diacylated and triacylated lipopeptides, respectively. Additionally, CD14 binds electronegative LDL, mediating cytokine release induced by LDL(-). As a member of the lipopolysaccharide (LPS) receptor complex, which includes CD14, LY96, and TLR4, CD14 interacts with LPAR1, highlighting its versatile roles in immune and signaling pathways.

Verified Bioactivity

Measured by its ability to enhance LPS-stimulated IL-8 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 1.202 ng/mL, corresponding to a specific activity is 8.319×105 U/mg.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession

    B3Y6B8 (T20-M344)

  • Gene ID
    697482  [NCBI]
  • Molecular Construction
    • N-term
    • CD14 (T20-M344)
      Accession # B3Y6B8
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD14; Monocyte Differentiation Antigen CD14; CD14 Molecule; CD14 Antigen; Myeloid Cell-Specific Leucine-Rich Glycoprotein; My23 Antigen

  • AA Sequence

    TTPEPCELDDEDFRCVCNFSEPHPDWSEAFQCVSAVEVEIRVGGLSLEPFLTRVDPDADPRQYADTIKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLQELTLEDLEITGTMPPLPLEATGLALSSLRLHNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLIAALCPHKFPALQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATANPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRRPRPDELPQVDNLALDGNPFLVPGTALPQEGSM

  • Molecular Weight

    Approximately 44-48 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CD14 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • CD14 Protein, Cynomolgus (HEK293, His) Product Image