CD157 Protein, Mouse (HEK293, His)

CD157 Protein, Mouse (HEK293, His) is a recombinant mouse CD157 expressed in HEK 293 cells with a His tag at the N-terminus. CD157 Protein is a cell surface receptor and an immunoregulatory molecule^[1][2].

CD157, also known as bone marrow stromal cell antigen 1 (BST-1), is a pleiotropic ectoenzyme which belongs to the CD38 family and to the growing number of leukocyte surface molecules known to act independently as both receptors and enzymes. BST-1 is a glycosyl phosphotidylinositol-anchored protein that stimulates pre-B-cell growth and has adenosine diphosphate (ADP)-ribosyl cyclase and cyclic ADP-ribose (cADPR) hydrolase activity^[1][2].

Mouse

HEK293

C-6*His

Q64277 (A25-E285)

12182  [NCBI]

ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRREHHHHHH

35-45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Hussain AM, et, al. Functional expression of secreted mouse BST-1 in yeast. Protein Expr Purif. 1998 Feb;12(1):133-7.  [Content Brief]

  [2]. Ortolan E, et, al. CD157, the Janus of CD38 but with a unique personality. Cell Biochem Funct. 2002 Dec;20(4):309-22.  [Content Brief]