CD20/MS4A1 Protein, Cynomolgus (HEK293, His)

CD20/MS4A1 protein is a B lymphocyte membrane protein that plays a crucial regulatory role in cellular calcium influx, which is essential for the development, differentiation and activation of B lymphocytes. As part of a store-operated calcium (SOC) channel, it promotes calcium influx upon B cell receptor/BCR activation. CD20/MS4A1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD20/MS4A1 protein, expressed by HEK293 , with C-His labeled tag.

The CD20/MS4A1 protein, a B-lymphocyte-specific membrane protein, plays a crucial role in regulating cellular calcium influx essential for the development, differentiation, and activation of B-lymphocytes. It functions as a component of the store-operated calcium (SOC) channel, promoting calcium influx upon activation by the B-cell receptor/BCR. CD20/MS4A1 forms homotetramers, contributing to its structural organization and functional role in calcium signaling. Notably, it interacts with both the heavy and light chains of cell surface IgM, the antigen-binding components of the BCR, highlighting its involvement in the B-cell receptor complex and underscoring its significance in B-cell activation and immune responses.

Cynomolgus

HEK293

C-8*His

A0A7N9D9P6 (R25-A288)

/

Partial

RPILEVPESITGPWKGDVNIPCTYGPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVNQKVPGDVSLQLSTLEMDDQSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKEQTNNQEPIKVATLSTLLFKPAMVADSGSYFCAAKGRVGSEQRSDIVKFVVKDSSKLLKTKTEAPTTMRHPLKATSTVKQSWDWTTDVDGYLGATSAGPGLNSA

Approximately 35-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.