CD200R1 Protein, Cynomolgus (243a.a, HEK293, His)
CD200R1 Protein is an Ig superfamily transmembrane glycoprotein expressed on the surface of myeloid cells. CD200R1 Protein can also be induced in certain T-cell subsets. CD200R1 signaling inhibits the expression of proinflammatory molecules. CD200R1 Protein, Cynomolgus (243a.a, HEK293, His) is the recombinant cynomolgus-derived CD200R1 protein, expressed by HEK293, with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD200R1 Protein is an Ig superfamily transmembrane glycoprotein expressed on the surface of myeloid cells. CD200R1 Protein can also be induced in certain T-cell subsets. CD200R1 signaling inhibits the expression of proinflammatory molecules[1]. CD200R1 Protein, Cynomolgus (243a.a, HEK293, His) is the recombinant cynomolgus-derived CD200R1 protein, expressed by HEK293, with C-His labeled tag.
Background
CD200R1 is an Ig superfamily transmembrane glycoprotein expressed on the surface of myeloid cells; it can also be induced in certain T-cell subsets. CD200R1 interacts with CD200, which is also an Ig superfamily transmembrane glycoprotein, to down regulate myeloid cell functions. CD200 is expressed on the surface of a variety of cells including neurons, epithelial cells, endothelial cells, fibroblasts, lymphoid cells, and astrocytes. The regulation of CD200R1 signaling can occur by posttranslational modification-namely, phosphorylation of tyrosines in the CD200R1 cytoplasmic tail-or by the inducible expression or downregulation of either CD200R1 or CD200. The CD200:CD200R1 inhibitory signaling pathway has been implicated in playing a prominent role in limiting inflammation in a wide range of inflammatory diseases. CD200R1 signaling inhibits the expression of proinflammatory molecules including tumor necrosis factor, interferons, and inducible nitric oxide synthase in response to selected stimuli[1].
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
XP_005548207 (E25-L267)
-
Gene ID102139962
-
Protein Length
Partial
-
Synonyms
CD200R1; CD200 Cell Surface Glycoprotein Receptor; Prev. MOX2R; MOX2 Receptor; CD200R; Cell Surface Glycoprotein Receptor CD200; OX2R; CD200R1 Protein; HCRTR2; CRTR2; Cell Surface Glycoprotein CD200 Receptor 1; CD200 Receptor 1; Cell Surface Glycoprotein
-
AA Sequence
EGAAQSNNSLMLQTSKENHTLASNSLCMDEKQITQNHSKVLAEVNISWPVQMARNAVLCCPPIEFRNLIVITWEIILRGQPSCTKTYRKDTNETKETNCTDERITWVSTPDQNSDLQIHPVAITHDGYYRCIMATPDGNFHRGYHLQVLVTPEVTLFESRNRTAVCKAVAGKPAAQISWIPAGDCAPTEQEYWGNGTVTVKSTCHWEGHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKL
-
Predicted Molecular Mass
28.1 kDa
-
Molecular Weight
Approximately 67-77 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
