Copy Link Print Information

CD200R1L Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD200R1L protein is a potential receptor for the CD200/OX2 cell surface glycoprotein and has been shown to play a role in mediating cellular responses associated with CD200 signaling. As a receptor, CD200R1L may engage in complex interactions with CD200, contributing to immune regulation and cellular communication. CD200R1L Protein, Human (HEK293, His) is the recombinant human-derived CD200R1L protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD200R1L Protein, Human (HEK293, His)
  • Experimental Validation Results for CD200R1L Protein, Human (HEK293, His)
  • CD200R1L Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The CD200R1L protein is a potential receptor for the CD200/OX2 cell surface glycoprotein and has been shown to play a role in mediating cellular responses associated with CD200 signaling. As a receptor, CD200R1L may engage in complex interactions with CD200, contributing to immune regulation and cellular communication. CD200R1L Protein, Human (HEK293, His) is the recombinant human-derived CD200R1L protein, expressed by HEK293 , with C-His labeled tag.

Background

CD200R1L Protein appears to function as a potential receptor for the CD200/OX2 cell surface glycoprotein. This designation suggests a role in mediating cellular responses associated with CD200 signaling. As a receptor, CD200R1L likely participates in the intricate interactions between CD200 and its binding partner, contributing to the modulation of immune responses and cell communication. Exploring the specific mechanisms and downstream effects of CD200R1L's interaction with CD200/OX2 could deepen our understanding of its role in immune regulation and cellular processes, offering insights into its potential implications in health and disease.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Human CD200 (HY-P70476) is Immobilized at 2 μg/mL (100 µL/well) can bind Human CD200R1L. The ED50 for this effect is 1.605 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human CD200 (HY-P70476) is Immobilized at 2 μg/mL (100 µL/well) can bind Human CD200R1L. The ED50 for this effect is 1.605 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q6Q8B3-1 (G24-L239)

  • Gene ID
    344807  [NCBI]
  • Molecular Construction
    • N-term
    • CD200R1L (M1-L239)
      Accession # Q6Q8B3
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD200R1L; Cell Surface Glycoprotein CD200 Receptor 2; CD200 Receptor 1 Like; Cell Surface Glycoprotein OX2 Receptor 2; CD200RLa; CD200 Receptor-Like 2; CD200R2; CD200 Receptor 2; CD200 Cell Surface Glycoprotein Receptor-Like 2; CD200 Cell Surface Glycopro

  • AA Sequence

    GKQMTQNYSTIFAEGNISQPVLMDINAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTVERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHRGYHLQVLVTPEVNLFQSRNITAVCKAVTGKPAAQISWIPEGSILATKQEYWGNGTVTVKSTCPWEGHKSTVTCHVSHLTGNKSLSVKLNSGLRTSGSPALSLL

  • Molecular Weight

    Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human CD200 (HY-P70476) is Immobilized at 2 μg/mL (100 µL/well) can bind Human CD200R1L. The ED50 for this effect is 1.605 μg/mL.

  • CD200R1L Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD200R1L Protein, Human (HEK293, His)
  • Experimental Validation Results for CD200R1L Protein, Human (HEK293, His)
  • CD200R1L Protein, Human (HEK293, His) Product Image