CD28 Protein, Mouse (HEK293, His)
CD28 Protein, a crucial regulator of T-cell activation, promotes cell proliferation, cytokine production, and T-cell survival. It enhances IL4 and IL10 production when combined with TCR/CD3 ligation and CD40L costimulation. CD28 Protein exists as a disulfide-linked homodimer and interacts with DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2 (By similarity). CD28 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD28 protein, expressed by HEK293, with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD28 Protein, a crucial regulator of T-cell activation, promotes cell proliferation, cytokine production, and T-cell survival. It enhances IL4 and IL10 production when combined with TCR/CD3 ligation and CD40L costimulation. CD28 Protein exists as a disulfide-linked homodimer and interacts with DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2 (By similarity). CD28 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD28 protein, expressed by HEK293, with C-His labeled tag.
Background
CD28 Protein, a key player in T-cell activation, is involved in inducing cell proliferation, cytokine production, and promoting T-cell survival. It enhances the production of IL4 and IL10 in T-cells when combined with TCR/CD3 ligation and CD40L costimulation. CD28 Protein exists as a homodimer through disulfide-linkage and interacts with DUSP14. It binds to CD80/B7-1 and CD86/B7-2/B70, and also has an interaction with GRB2 (By similarity).
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P31041 (N20-L150)
-
Gene ID12487
-
Molecular Construction
-
N-term
-
CD28 (N20-L50)
Accession # P31041 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD28; CD28 Antigen; CD28 Molecule; IMD123; T-Cell-Specific Surface Glycoprotein CD28; Tp44; T-Cell-Specific Surface Glycoprotein; TP44; CD28 Antigen (Tp44)
-
AA Sequence
NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKL
-
Predicted Molecular Mass
16.8 kDa
-
Molecular Weight
Approximately 40-50 kDa,based on Bis-Tris PAGE under reducing conditions,due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)