CD3 epsilon Protein, Rhesus Macaque (HEK293, His)
Based on 1 Customer Validation
CD3 epsilon Protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation. CD3 epsilon Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD3 epsilon protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD3 epsilon Protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation[1]. CD3 epsilon Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD3 epsilon protein, expressed by HEK293 , with C-His labeled tag.
Background
The CD3 epsilon protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation. The CD3D/CD3E and CD3G/CD3E heterodimers form trimers with TCRalpha and TCRbeta, completing the TCR-CD3 complex. CD3E's interactions with CD6 and NCK1 highlight its multifaceted role in T-cell responses[1].
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-His
-
Accession
XP_001097204.1 (Q22-D117)
-
Molecular Construction
-
N-term
-
CD3 epsilon (Q22-D117)
Accession # XP_001097204.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD3E; T3E; CD3 Epsilon Subunit Of T-Cell Receptor Complex; T-Cell Antigen Receptor Complex, Epsilon Subunit Of T3; T-Cell Surface Glycoprotein CD3 Epsilon Chain; CD3e Molecule; CD3-Epsilon; CD3e Antigen; CD3epsilon; CD3E Protein; CD3e Antigen, Epsilon Pol
-
AA Sequence
QDGNEEMGSITQTPYHVSISGTTVILTCSQHLGSEVQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD
-
Predicted Molecular Mass
12.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
