1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD3e
  5. CD3 epsilon Protein, Rhesus Macaque (HEK293, His)

CD3 epsilon Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P76791
Handling Instructions Technical Support

CD3 epsilon Protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation. CD3 epsilon Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD3 epsilon protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD3 epsilon Protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation[1]. CD3 epsilon Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD3 epsilon protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD3 epsilon protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation. The CD3D/CD3E and CD3G/CD3E heterodimers form trimers with TCRalpha and TCRbeta, completing the TCR-CD3 complex. CD3E's interactions with CD6 and NCK1 highlight its multifaceted role in T-cell responses[1].

Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

XP_001097204.1 (Q22-D117)

Gene ID
Molecular Construction
N-term
CD3 epsilon (Q22-D117)
Accession # XP_001097204.1
His
C-term
Protein Length

Partial

Synonyms
T-Cell Surface Glycoprotein CD3 Epsilon Chain; T-Cell Surface Antigen T3/Leu-4 Epsilon Chain; CD3e; CD3E; T3E
AA Sequence

QDGNEEMGSITQTPYHVSISGTTVILTCSQHLGSEVQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD

Molecular Weight

Approximately 12.3 kDa.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD3 epsilon Protein, Rhesus Macaque (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD3 epsilon Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P76791
Quantity:
MCE Japan Authorized Agent: