CD3 epsilon Protein, Rhesus Macaque (HEK293, His)

CD3 epsilon Protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation^[1]. CD3 epsilon Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD3 epsilon protein, expressed by HEK293 , with C-His labeled tag.

The CD3 epsilon protein, a vital component of the TCR-CD3 complex on T-lymphocytes, is pivotal for adaptive immune responses. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. CD3E is crucial for proper T-cell development and contributes to TCR-CD3 complex internalization and down-regulation. The CD3D/CD3E and CD3G/CD3E heterodimers form trimers with TCRalpha and TCRbeta, completing the TCR-CD3 complex. CD3E's interactions with CD6 and NCK1 highlight its multifaceted role in T-cell responses^[1].

Rhesus Macaque

HEK293

C-His

XP_001097204.1 (Q22-D117)

699467  [NCBI]

Partial

QDGNEEMGSITQTPYHVSISGTTVILTCSQHLGSEVQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD

Approximately 12.3 kDa.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.