CD30/TNFRSF8 Protein, Human (HEK293, hFc)
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (HEK293, hFc) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (HEK293, hFc) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD30/TNFRSF8 protein, as a receptor for TNFSF8/CD30L, plays a key role in the regulation of cell growth and transformation of activated lymphoblasts. In addition, it may participate in the regulation of gene expression through the activation of NF-kappa-B signaling, thereby promoting a variety of cellular processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P28908 (F19-K379)
-
Molecular Construction
-
N-term
-
CD30 (F19-K379)
Accession # P28908 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TNFRSF8; CD30L Receptor; Prev. D1S166E; Tumor Necrosis Factor Receptor Superfamily, Member 8; Prev. CD30; Cytokine Receptor CD30; KI-1; TNFRSF8 Protein; Tumor Necrosis Factor Receptor Superfamily Member 8; CD30 Antigen; Lymphocyte Activation Antigen CD30;
-
AA Sequence
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
-
Predicted Molecular Mass
65.2 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
